Select country change
Shopping cart (0 , 0,00 ) Menu Search
Manufactured by BioVendor

sPLA2-X Human E. coli

  • Regulatory status:RUO
  • Type:Recombinant
  • Source:E. coli
  • Other names:Group 10 secretory phospholipase A2, Group X secretory phospholipase A2, GX sPLA2, Phosphatidylcholine 2-acylhydrolase 10, PLA2G10
  • Species:Human
Please select your region to see available products and prices.
Cat. No. Size Price


New RD172065025 0.025 mg
RD172065100 0.1 mg
PubMed Product Details
Technical Data

Type

Recombinant

Description

Total 139 AA. MW: 15.5 kDa (calculated). UniProtKB acc.no. O15496. N-Terminal His-tag, 16 extra AA (highlighted).

Amino Acid Sequence

MRGSHHHHHHGMASHMGILELAGTVGCVGPRTPIAYMKYGCFCGLGGHGQPRDAIDWCCHGHDCCYTRAEEAGCSPKTERYSWQCVNQSVLCGPAENKCQELLCKCDQEIANCLAQTEYNLKYLFYPQFLCEPDSPKCD

Source

E. coli

Purity

>95%

SDS-PAGE Gel

12% SDS-PAGE separation of Human sPLA2-X
1. M.W. marker – 14, 21, 31, 45, 66, 97 kDa
2. reduced and heated sample, 5μg/lane
3. non-reduced and non-heated sample, 5μg/lane

Endotoxin

< 1.0 EU/ug

Formulation

Filtered (0,4 μm) and lyophilized in 0.5 mg/mL in 0.01 M Tris buffer pH 7.2.

Reconstitution

Add deionized water to prepare a working stock solution of approximately 0.5 mg/mL and let the lyophilized pellet dissolve completely. Filter sterilize your culture media/working solutions containing this non-sterile product before using in cell culture.

Applications

Western blotting

Shipping

At ambient temperature. Upon receipt, store the product at the temperature recommended below.

Storage/Expiration

Store the lyophilized protein at –80 °C. Lyophilized protein remains stable until the expiry date when stored at –80 °C. Aliquot reconstituted protein to avoid repeated freezing/thawing cycles and store at –80 °C for long term storage. Reconstituted protein can be stored at 4 °C for a week.

Quality Control Test

BCA to determine quantity of the protein.

SDS PAGE to determine purity of the protein.

LAL to determine quantity of endotoxin.

Note

This product is intended for research use only.

Related Products Documents