Select country change
Shopping cart (0 , 0,00 ) Menu Search
Manufactured by BioVendor

sRANK Receptor Human E. coli

  • Regulatory status:RUO
  • Type:Recombinant protein
  • Source:E. coli
  • Other names:TNFRSF11A, ODFR (osteoclast differentiation factor receptor), ODAR (osteoclast differentiation and activation receptor), TRANCE Receptor
  • Species:Human
Please select your region to see available products and prices.
Cat. No. Size Price


RBG10284020 20 µg
RBG10284100 100 μg
RBG10284250 250 µg
PubMed Product Details
Technical Data

Type

Recombinant protein

Description

RANKL and RANK are members of the TNF superfamily of ligands and receptors that play an important role in the regulation of specific immunity and bone turnover. RANK (receptor) was originally identified as a dendritic cell-membrane protein, which, by interacting with RANKL, augments the ability of dendritic. These dendritic cells then stimulate naïve T-cell proliferation, and promote the survival of RANK + T-cells. RANK is also expressed in a variety of tissues, including skeletal muscle, thymus, liver, colon, small intestine, and adrenal gland. The RANK/RANKL interaction is important in the regulation of osteoclastogenesis, and in dendritic cell-mediated T-cell immune responses. Impairments in RANK signaling have been implicated in the induction of expansile osteolysis and Paget's disease of bone (PDB2). Recombinant Human sRANK Receptor is a 19.3 kDa polypeptide containing the TNFR-homologous, cysteine-rich portion of the extracellular domain of RANK receptor (175 amino acid residues).

Amino Acid Sequence

MQIAPPCTSEKHYEHLGRCCNKCEPGKYMSSKCTTTSDSVCLPCGPDEYLDSWNEEDKCLLHKVCDTGKALVAVVAGNSTTPRRCACTAGYHWSQDCECCRRNTECAPGLGAQHPLQLNKDTVCKPCLAGYFSDAFSSTDKCRPWTNCTFLGKRVEHHGTEKSDAVCSSSLPARK

Source

E. coli

Purity

98%

Biological Activity

Determined by its ability to inhibit sRANKL induced NF-kappaB in RAW264.7 cells in the absence of any cross-linking. The expected ED50 for this effect in the presence of 15 ng/ml of recombinant sRANKL, is 30–50 ng/ml.

Endotoxin

Endotoxin level is <0.1 ng/μg of protein (<1EU/μg).

Reconstitution

Centrifuge the vial prior to opening. Reconstitute in water to a concentration of 0.1–1.0 mg/ml. Do not vortex. For extended storage, it is recommended to further dilute in a buffer containing a carrier protein (example 0.1% BSA) and store in working aliquots at-20°C to –80°C.

Storage/Expiration

 –20°C

Summary

Research topic

Others

Related Products Docs