Select country change
Shopping cart (0 , 0,00 ) Menu Search
Manufactured by BioVendor

sTNF Receptor Type II Human E. coli

  • Regulatory status:RUO
  • Type:Recombinant protein
  • Source:E. coli
  • Other names:Soluble Tumor Necrosis Factor type II, TNFRSF1B, TNFR75, p75, CD120b, TNFR80, p80
  • Species:Human
Please select your region to see available products and prices.
Cat. No. Size Price


RBG10328005 5 µg
RBG10328020 20 µg
RBG10328100 100 μg
PubMed Product Details
Technical Data

Type

Recombinant protein

Description

TNFRII is a member of the TNFR family of transmembrane proteins, and is expressed in immune cells and certain endothelial cells. It is a high affinity receptor for TNF-α, but manifests a lower affinity to TNF-β. Signaling through this receptor regulates various biological processes, including cell proliferation, differentiation, apoptosis, lipid metabolism, coagulation, and neurotransmission. Soluble TNFRII is capable of inhibiting TNF-α-induced activities by acting as a decoy receptor. The human TNFRII gene encodes for a 461 amino acid type I transmembrane protein, which contains a 22 amino acid signal sequence, a 235 amino acid extracellular domain, a 30 amino acid transmembrane domain, and a 174 amino acid cytoplasmic domain. Recombinant Human sTNF Receptor Type II is an 18.9 kDa protein (174 amino acid residues) comprising the cysteine-rich, ligand binding portion of the extracellular domain of the TNFRII protein.

Amino Acid Sequence

MAPEPGSTCRLREYYDQTAQMCCSKCSPGQHAKVFCTKTSDTVCDSCEDSTYTQLWNWVPECLSCGSRCSSDQVETQACTREQNRICTCRPGWYCALSKQEGCRLCAPLRKCRPGFGVARPGTETSDVVCKPCAPGTFSNTTSSTDICRPHQICNVVAIPGNASMDAVCTSTSP

Source

E. coli

Purity

98%

Biological Activity

Determined by its inhibitory effect of the TNF-α mediated cytotoxicity in murine L-929 cells. The ED50 for this effect in the presence of 0.25 ng/ml of recombinant human TNF-α, is 0.125 µg/ml.

Endotoxin

Endotoxin level is <0.1 ng/μg of protein (<1EU/μg).

Reconstitution

Centrifuge the vial prior to opening. Reconstitute in water to a concentration of 0.1–1.0 mg/ml. Do not vortex. For extended storage, it is recommended to further dilute in a buffer containing a carrier protein (example 0.1% BSA) and store in working aliquots at –20°C to –80°C.

Storage/Expiration

 –20°C

Summary

Research topic

Immune Response, Infection and Inflammation, Neural tissue markers

Related Products Docs