Type
Recombinant protein
Description
TACI, a member of the TNF Receptor superfamily, is expressed in the small intestine, spleen, thymus, peripheral blood leukocytes, activated T cells, and resting B cells. TACI can bind to both APRIL and BAFF, stimulate the activation of transcription factors NF-κB and AP-1, and can mediate the calcineurin-dependent activation of NF-AT (nuclear-factor of activated T cells). TACI also plays a key role in the stimulation of B and T cell function. Soluble TACI inhibits APRIL-stimulated proliferation of primary B cells by blocking the binding of APRIL to the membrane-anchored TACI receptor. Recombinant Human TACI is a soluble 159 amino acid polypeptide (17.8 kDa) comprising the TNFR homologous, cysteine-rich extracellular domain of the TACI protein.
Amino Acid Sequence
SGLGRSRRGGRSRVDQEERFPQGLWTGVAMRSCPEEQYWDPLLGTCMSCKTICNHQSQRTCAAFCRSLSCRKEQGKFYDHLLRDCISCASICGQHPKQCAYFCENKLRSPVNLPPELRRQRSGEVENNSDNSGRYQGLEHRGSEASPALPGLKLSADQV
Source
E. coli
Purity
98%
Biological Activity
Determined by its ability to block human BAFF induced T2B cell survival using a concentration range of 1.0–3.0 µg/ml.
Endotoxin
Endotoxin level is <0.1 ng/μg of protein (<1EU/μg).
Reconstitution
Centrifuge the vial prior to opening. Reconstitute in water to a concentration of 0.1–1.0 mg/ml. Do not vortex. For extended storage, it is recommended to further dilute in a buffer containing a carrier protein (example 0.1% BSA) and store in working aliquots at-20°C to –80°C.
Storage/Expiration
–20°C