Select country change
Shopping cart (0 , 0,00 ) Menu Search
Manufactured by BioVendor

TAFA-2 Human E. coli

  • Regulatory status:RUO
  • Type:Recombinant protein
  • Source:E. coli
  • Other names:Chemokine-like protein TAFA-2, FAM19A2
  • Species:Human
Please select your region to see available products and prices.
Cat. No. Size Price


RBG10303005 5 µg
RBG10303020 20 µg
RBG10303100 100 μg
PubMed Product Details
Technical Data

Type

Recombinant protein

Description

TAFA proteins are a newly discovered family of proteins, which are distantly related to MIP-1α, a member of the CC-chemokine family. TAFA mRNAs are highly expressed in specific brain regions. The biological function of TAFA-2 is still unknown. Recombinant Human TAFA-2 is an 11.2 kDa protein consisting of 101 amino acid residues.

Amino Acid Sequence

ANHHKAHHVKTGTCEVVALHRCCNKNKIEERSQTVKCSCFPGQVAGTTRAAPSCVDASIVEQKWWCHMQPCLEGEECKVLPDRKGWSCSSGNKVKTTRVTH

Source

E. coli

Purity

98%

Biological Activity

Data not available.

Endotoxin

Endotoxin level is <0.1 ng/μg of protein (<1EU/μg).

Reconstitution

Centrifuge the vial prior to opening. Reconstitute in water to a concentration of 0.1–1.0 mg/ml. Do not vortex. For extended storage, it is recommended to further dilute in a buffer containing a carrier protein (example 0.1% BSA) and store in working aliquots at –20°C to –80°C.

Storage/Expiration

 –20°C

Summary

Research topic

Chemokines, Cytokines and chemokines and related molecules

Related Products Docs