Select country change
Shopping cart (0 , 0,00 ) Menu Search
Manufactured by BioVendor

TGF-β2 (mammalian derived) Human HEK293 cells

  • Regulatory status:RUO
  • Type:Recombinant protein
  • Source:HEK293 cells
  • Other names:Transforming Growth Factor-ß2, Glioblastoma-derived T cell suppressor factor, BSC-1, Cetermin, Polyergin
  • Species:Human
Please select your region to see available products and prices.
Cat. No. Size Price


RBG10313001 1 µg
RBG10313005 5 µg
RBG10313100 100 μg
PubMed Product Details
Technical Data

Type

Recombinant protein

Amino Acid Sequence

ALDAAYCFRNVQDNCCLRPLYIDFKRDLGWKWIHEPKGYNANFCAGACPYLWSSDTQHSRVLSLYNTINPEASASPCCVSQDLEPLTILYYIGKTPKIEQLSNMIVKSCKCS

Source

HEK293 cells

Purity

98%

Biological Activity

Determined by its ability to inhibit the mouse IL-4-dependent proliferation of mouse HT-2 cells. The ED50 was found to be 0.2 ng/ml, corresponding to a specific activity of 5×106 units/mg.

Endotoxin

Endotoxin level is <0.1 ng/μg of protein (<1EU/μg).

Reconstitution

Centrifuge the vial prior to opening. Reconstitute in water to a concentration of 0.1–1.0 mg/ml. Do not vortex. For extended storage, it is recommended to further dilute in a buffer containing a carrier protein (example 0.1% BSA) and store in working aliquots at –20°C to –80°C.

Storage/Expiration

 –20°C

Summary

Research topic

Apoptosis, Cardiovascular disease, Coronary artery disease, Immune Response, Infection and Inflammation, Oncology

Related Products Docs