Select country change
Shopping cart (0 , 0,00 ) Menu Search
Manufactured by BioVendor

TGF-alpha Human E. coli

  • Regulatory status:RUO
  • Type:Recombinant protein
  • Source:E. coli
  • Other names:Transforming Growth Factor-α, Sacroma growth factor, TGF-type I, ETGF
  • Species:Human
Please select your region to see available products and prices.
Cat. No. Size Price


RBG10309020 20 µg
RBG10309100 100 μg
RBG10309250 250 µg
PubMed Product Details
Technical Data

Type

Recombinant protein

Description

TGF-α is an EGF-related polypeptide growth factor that signals through the EGF receptor, and stimulates the proliferation of a wide range of epidermal and epithelial cells. It is produced by monocytes, keratinocytes, and various tumor cells. TGF-α induces transformation anchorage independence in cultured cells. Human, murine and rat TGF-α are cross-species reactive. Recombinant human TGF-α is a 50 amino acid polypeptide (5.5 kDa) which shares approximately 40% sequence homology with EGF, including 6 conserved cysteine residues, which form 3 intramolecular disulfide bonds.

Amino Acid Sequence

VVSHFNDCPDSHTQFCFHGTCRFLVQEDKPACVCHSGYVGARCEHADLLA

Source

E. coli

Purity

98%

Biological Activity

The ED 50 as determined by the dose-dependent stimulation of thymidine uptake by BALB/c 3T3 cells is ≤ 0.2 ng/ml, corresponding to a specific activity of ≥ 5×10 6 units/mg.

Endotoxin

Endotoxin level is <0.1 ng/μg of protein (<1EU/μg).

Reconstitution

Centrifuge the vial prior to opening. Reconstitute in water to a concentration of 0.1–1.0 mg/ml. Do not vortex. For extended storage, it is recommended to further dilute in a buffer containing a carrier protein (example 0.1% BSA) and store in working aliquots at –20°C to –80°C.

Storage/Expiration

 –20°C

Summary

Research topic

Cardiovascular disease, Coronary artery disease, Oncology

Related Products Docs