Select country change
Shopping cart (0 , 0,00 ) Menu Search
Manufactured by BioVendor

TGF-beta 2 (insect derived) Human (BTI-Tn-5B1-4) Hi-5 Insect cells*

  • Regulatory status:RUO
  • Type:Recombinant protein
  • Source:(BTI-Tn-5B1-4) Hi-5 Insect cells*
  • Other names:Transforming Growth Factor-ß2, Glioblastoma-derived T cell suppressor factor, BSC-1, Cetermin, Polyergin
  • Species:Human
Please select your region to see available products and prices.
Cat. No. Size Price


RBG10312001 1 µg
RBG10312005 5 µg
RBG10312100 100 μg
PubMed Product Details
Technical Data

Type

Recombinant protein

Description

The three mammalian isoforms of TGF-β, TGF-β1, β2, and β3, signal through the same receptor and elicit similar biological responses. They are multifunctional cytokines that regulate cell proliferation, growth, differentiation and motility, as well as synthesis and deposition of the extracellular matrix. They are involved in various physiological processes, including embryogenesis, tissue remodeling and wound healing. They are secreted predominantly as latent complexes, which are stored at the cell surface and in the extracellular matrix. The release of the biologically active TGF-β isoform from a latent complex involves proteolytic processing of the complex and /or induction of conformational changes by proteins such as thrombospondin-1. TGF-β2 has been shown to exert suppressive effects on IL-2-dependent T-cell growth, and may also have an autocrine function in enhancing tumor growth by suppressing immuno-surveillance of tumor development. Recombinant Human TGF-β2 is a 25.0 kDa protein composed of two identical 112 amino acid polypeptide chains linked by a single disulfide bond.

Amino Acid Sequence

ALDAAYCFRNVQDNCCLRPLYIDFKRDLGWKWIHEPKGYNANFCAGACPYLWSSDTQHSRVLSLYNTINPEASASPCCVSQDLEPLTILYYIGKTPKIEQLSNMIVKSCKCS

Source

(BTI-Tn-5B1-4) Hi-5 Insect cells*

Purity

98%

Biological Activity

Determined by its ability to inhibit the mouse IL-4-dependent proliferation of mouse HT-2 cells. The ED50 was found to be ≤ 0.2 ng/ml, corresponding to a specific activity of ≥ 5×106 units/mg.

Endotoxin

Endotoxin level is <0.1 ng/μg of protein (<1EU/μg).

Reconstitution

Centrifuge the vial prior to opening. Reconstitute in water to a concentration of 0.1–1.0 mg/ml. Do not vortex. For extended storage, it is recommended to further dilute in a buffer containing a carrier protein (example 0.1% BSA) and store in working aliquots at –20°C to –80°C.

Storage/Expiration

 –20°C

Summary

Research topic

Apoptosis, Cardiovascular disease, Coronary artery disease, Immune Response, Infection and Inflammation, Oncology

Related Products Docs