Select country set
language
Menu Shopping cart 0,00 Search
Manufactured by BioVendor

Thymosin-β4 Human E. coli

  • Regulatory status:RUO
  • Type:Recombinant protein
  • Source:E. coli
  • Other names:Tß-4, Hematopoietic system regulatory peptide, Seraspenide, TMSB4X, TB4X, TMSB4
  • Species:Human
Please select your region to see available products and prices.
Cat. No. Size Price


RBG10316020 20 µg
RBG10316100 100 μg
RBG10316250 250 µg
PubMed Product Details
Technical Data

Type

Recombinant protein

Description

Thymosin-β4 is a small, actin-sequestering protein belonging to the thymosin-β family that is found at high concentrations within the spleen, thymus, and peritoneal macrophages, where it is most notably responsible for the organization of cytoskeletal structure. In mammalian tissues, this protein acts as a modulator for the polymerization/de­polymerization of actin through the formation of a 1:1 complex with the monomer G (globular)-actin, and inhibits actin’s polyme­rization to form F (filamentous) actin, which together with other proteins binds microfilaments to construct the cytoskeleton. Commonly found at significant quantities within the brain, lungs, liver, kidneys, testes, and heart, thymosin-β4 has also been shown to be synthesized by cells unrelated to the reticuloendothelial system, such as myoblasts and fibroblasts, and expressed at irregular levels by several hemopoietic cell lines, malignant lymphoid cells and myeloma cells. In addition to regulating actin polymerization, research has also found thymosin-β4 to stimulate the secretion of hypothalamic luteinizing hormone-releasing hormone and luteinizing hormone, inhibit the migration of peritoneal macrophages, induce phenotypic changes in T cell lines during early host defense mechanisms, and inhibit the progression of hematopoietic pluripotent stem cells into the S-phase. Recombinant Human Thymosin-β4 is a 5.2 kDa glycoprotein containing 45 amino acid residues.

Amino Acid Sequence

RMSDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES

Source

E. coli

Purity

95%

Biological Activity

Pretreatment of primary lung fibroblasts with recombinant Thymosin-β4, using a concentration of 0.5 – 10 µg/ml, produces a protective effect against hydrogen peroxide induced cell death.

Endotoxin

Endotoxin level is <0.1 ng/μg of protein (<1EU/μg).

Reconstitution

Centrifuge the vial prior to opening. Reconstitute in water to a concentration of 0.1–1.0 mg/ml. Do not vortex. For extended storage, it is recommended to further dilute in a buffer containing a carrier protein (example 0.1% BSA) and store in working aliquots at –20°C to –80°C.

Storage/Expiration

 –20°C

Summary

Research topic

Apoptosis, Oncology

Related Products Docs