Select country change
Shopping cart (0 , 0,00 ) Menu Search
Manufactured by BioVendor

TIMP-1 Human E. coli

  • Regulatory status:RUO
  • Type:Recombinant protein
  • Source:E. coli
  • Other names:Tissue inhibitor of metalloproteinases, EPA , TAK, Metalloproteinase Inhibitor 1, Erythroid-potentiating activity, Fibroblast collagenase inhibitor, Collagenase inhibitor, Tissue inhibitor of metalloproteinases 1 TIMP-1, TIMP1, CLGI, TIMP
  • Species:Human
Please select your region to see available products and prices.
Cat. No. Size Price


RBG10319002 2 µg
RBG10319010 10 µg
RBG10319100 100 μg
PubMed Product Details
Technical Data

Type

Recombinant protein

Description

TIMP-1 is an extracellular inhibitor of MMPs, including MMP-1, –2, –3, –7, –8, –9, –10, –11, –12, –13, and –16. It belongs to the I35 (TIMP) family of irreversible protease inhibitors that function as key modulators of extracellular matrix degradation during tissue development and remodeling. TIMP-1 can also act through an MMP-independent mechanism to promote erythropoiesis by stimulating proliferation and differentiation of erythroid progenitors. Recombinant Human TIMP-1 is a 20.6 kDa protein containing 184 amino acid residues.

Amino Acid Sequence

CTCVPPHPQTAFCNSDLVIRAKFVGTPEVNQTTLYQRYEIKMTKMYKGFQALGDAADIRFVYTPAMESVCGYFHRSHNRSEEFLIAGKLQDGLLHITTCSFVAPWNSLSLAQRRGFTKTYTVGCEECTVFPCLSIPCKLQSGTHCLWTDQLLQGSEKGFQSRHLACLPREPGLCTWQSLRSQIA

Source

E. coli

Purity

95%

Biological Activity

TIMP-1 activity was measured by its ability to inhibit human MMP-1-induced hydrolysis of a chromogenic peptide substrate at room temperature. Half maximal inhibition was obtained at a TIMP-1 concentration of approximately 0.5 μg/ml, when using an MMP-1 concentration of 1.6 μg/ml.

Endotoxin

Endotoxin level is <0.1 ng/μg of protein (<1EU/μg).

Reconstitution

Centrifuge the vial prior to opening. Reconstitute in water to a concentration of 0.1–1.0 mg/ml. Do not vortex. For extended storage, it is recommended to further dilute in a buffer containing a carrier protein (example 0.1% BSA) and store in working aliquots at-20°C to –80°C.

Storage/Expiration

 –20°C

Summary

Research topic

Extracellular matrix, Others

Summary

This gene belongs to the TIMP gene family. The proteins encoded by this gene family are natural inhibitors of the matrix metalloproteinases (MMPs), a group of peptidases involved in degradation of the extracellular matrix. In addition to its inhibitory role against most of the known MMPs, the encoded protein is able to promote cell proliferation in a wide range of cell types and may also have an anti-apoptotic function.

Related Products Docs