Select country change
Shopping cart (0 , 0,00 ) Menu Search
Manufactured by BioVendor

TIMP-2 Human E. coli

  • Regulatory status:RUO
  • Type:Recombinant protein
  • Source:E. coli
  • Other names:Tissue inhibitor of metalloproteinases 2, CSC-21K
  • Species:Human
Please select your region to see available products and prices.
Cat. No. Size Price


RBG10320002 2 µg
RBG10320010 10 µg
RBG10320100 100 μg
PubMed Product Details
Technical Data

Type

Recombinant protein

Description

TIMP-2 is an extracellular inhibitor of MMPs, including MMP-1, –2, –3, –7, –8, –9, –10, –12, –13, –14, –15, –16 and –19. It belongs to the I35 (TIMP) family of irreversible protease inhibitors that function as key modulators of extracellular matrix degradation during tissue development and remodeling. TIMP-2 can also act through an MMP-independent mechanism inhibiting endothelial cell proliferation in vitro and demonstrates anti-angiogenic activities in vivo. Recombinant Human TIMP-2 is a 21.8 kDa protein containing 194 amino acid residues.

Amino Acid Sequence

CSCSPVHPQQAFCNADVVIRAKAVSEKEVDSGNDIYGNPIKRIQYEIKQIKMFKGPEKDIEFIYTAPSSAVCGVSLDVGGKKEYLIAGKAEGDGKMHITLCDFIVPWDTLSTTQKKSLNHRYQMGCECKITRCPMIPCYISSPDECLWMDWVTEKNINGHQAKFFACIKRSDGSCAWYRGAAPPKQEFLDIEDP

Source

E. coli

Purity

95%

Biological Activity

TIMP-2 activity was measured by its ability to inhibit human MMP-1 induced hydrolysis of a chromogenic peptide substrate at room temperature. Half maximal inhibition was obtained at a TIMP-2 concentration of approximately 0.5 µg/ml, when using an MMP-1 concentration of 1.6 µg/ml.

Endotoxin

Endotoxin level is <0.1 ng/μg of protein (<1EU/μg).

Reconstitution

Centrifuge the vial prior to opening. Reconstitute in water to a concentration of 0.1–1.0 mg/ml. Do not vortex. For extended storage, it is recommended to further dilute in a buffer containing a carrier protein (example 0.1% BSA) and store in working aliquots at –20°C to –80°C.

Storage/Expiration

 –20°C

Summary

Research topic

Extracellular matrix, Others

Related Products Docs