Select country change
Shopping cart (0 , 0,00 ) Menu Search
Manufactured by BioVendor

TL-1A Human E. coli

  • Regulatory status:RUO
  • Type:Recombinant protein
  • Source:E. coli
  • Other names:TNFSF15, VEGI
  • Species:Human
Please select your region to see available products and prices.
Cat. No. Size Price


RBG10323005 5 µg
RBG10323020 20 µg
RBG10323100 100 μg
PubMed Product Details
Technical Data

Type

Recombinant protein

Description

TL-1A belongs to the TNF superfamily of ligands. It is expressed predominantly in endothelial cells, and to a lesser extent in the placenta, lung, kidney, skeletal muscle, pancreas, small intestine and colon. TL-1A inhibits endothelial cell proliferation and angiogenesis, and has been shown to induce NF-κB activation, caspase activity, and apoptosis in responding cell lines. TL-1A interacts with TNFRSF25/DR3 receptor, but can also bind to a decoy receptor TNFRSF21/DR6. Recombinant Human TL-1A is a 22.0 kDa polypeptide of 194 amino acid residues.

Amino Acid Sequence

QLRAQGEASVQFQALKGQEFAPSHQQVYAPLRADGDKPRAHLTVVRQTPTQHFKNQFPALHWEHELGLAFTKNRMNYTNKFLLIPESGDYFIYSQVTFRGMTSECSEIRQAGRPNKPDSITVVITKVTDSYPEPTQLLMGTKSVCEVGSNWFQPIYLGAMFSLQEGDKLMVNVSDISLVDYTKEDKTFFGAFLL

Source

E. coli

Purity

98%

Biological Activity

Determined by its ability to stimulate IFN-ɣ production by human PBMC using a concentration range of 10.0–100.0 ng/ml. Results may vary with PBMC donors.

Endotoxin

Endotoxin level is <0.1 ng/μg of protein (<1EU/μg).

Reconstitution

Centrifuge the vial prior to opening. Reconstitute in water to a concentration of 0.1–1.0 mg/ml. Do not vortex. For extended storage, it is recommended to further dilute in a buffer containing a carrier protein (example 0.1% BSA) and store in working aliquots at –20°C to –80°C.

Storage/Expiration

 –20°C

Summary

Research topic

Apoptosis, Cardiovascular disease, Coronary artery disease

Related Products Docs