Select country change
Shopping cart (0 , 0,00 ) Menu Search
Manufactured by BioVendor

TNF-β (E.coli-derived) Human E. coli

  • Regulatory status:RUO
  • Type:Recombinant protein
  • Source:E. coli
  • Other names:Tumor Necrosis Factor-β, TNFSF1, Lymphotoxin-alpha (LT-α)
  • Species:Human
Please select your region to see available products and prices.
Cat. No. Size Price


RBG10326005 5 µg
RBG10326020 20 µg
RBG10326100 100 μg
PubMed Product Details
Technical Data

Type

Recombinant protein

Description

TNF-β is a potent mediator of inflammatory and immune responses. It belongs to the TNF family of ligands, and signals through TNFR1 and TNFR2. TNF-β is produced by activated T and B lymphocytes, and has similar activities to TNF-α. Like TNF-α, TNF-β is involved in the regulation of various biological processes, including cell proliferation, differentiation, apoptosis, lipid metabolism, coagulation, and neurotransmission. TNF-β is secreted as a soluble polypeptide, but can form heterotrimers with lymphotoxin-β, which effectively anchors the TNF-β to the cell surface. TNF-β is cytotoxic to a wide range of tumor cells. Recombinant Human TNF-β is a secreted 172 amino acid protein (18.6 kDa) which forms an active non-disulfide-linked homotrimer structure in solution.

Amino Acid Sequence

MLPGVGLTPSAAQTARQHPKMHLAHSTLKPAAHLIGDPSKQNSLLWRANTDRAFLQDGFSLSNNSLLVPTSGIYFVYSQVVFSGKAYSPKATSSPLYLAHEVQLFSSQYPFHVPLLSSQKMVYPGLQEPWLHSMYHGAAFQLTQGDQLSTHTDGIPHLVLSPSTVFFGAFAL

Source

E. coli

Purity

98%

Biological Activity

The ED 50 as determined by the cytolysis of murine L929 cells in the presence of Actinomycin-D is ≤ 0.05 ng/ml, corresponding to a specific activity of ≥ 2×10 7 units/mg.

Endotoxin

Endotoxin level is <0.1 ng/μg of protein (<1EU/μg).

Reconstitution

Centrifuge the vial prior to opening. Reconstitute in water to a concentration of 0.1–1.0 mg/ml. Do not vortex. This solution can be stored at 2–8°C for up to 1 week. For extended storage, it is recommended to further dilute in a buffer containing a carrier protein (example 0.1% BSA) and store in working aliquots at –20°C to –80°C.

Storage/Expiration

 –20°C

Summary

Research topic

Apoptosis, Cardiovascular disease, Coronary artery disease, Immune Response, Infection and Inflammation, Lipoprotein metabolism, Neural tissue markers

Related Products Docs