Select country change
Shopping cart (0 , 0,00 ) Menu Search
Manufactured by BioVendor

TNF-α Rat E. coli

  • Regulatory status:RUO
  • Type:Recombinant protein
  • Source:E. coli
  • Other names:Cachectin, Tumor necrosis factor alpha, DIF
  • Species:Rat
Please select your region to see available products and prices.
Cat. No. Size Price


RBG30076005 5 µg
RBG30076020 20 µg
RBG30076100 100 μg
PubMed Product Details
Technical Data

Type

Recombinant protein

Description

TNF-α is a pleiotropic pro-inflammatory cytokine secreted by various cells, including adipocytes, activated monocytes, macrophages, B cells, T cells and fibroblasts. It belongs to the TNF family of ligands, and signals through two receptors, TNFR1 and TNFR2. TNF-α is cytotoxic to a wide variety of tumor cells, and is an essential factor in mediating the immune response against bacterial infections. TNF-α also plays a role in the induction of septic shock, autoimmune diseases, rheumatoid arthritis, inflammation, and diabetes. Human and murine TNF-α demonstrate significant cross-species reactivity. TNF-α exists in two forms; a type II transmembrane protein, and a mature soluble protein. The TNF-α transmembrane protein is proteolytically cleaved to yield a soluble, biologically active, 17 kDa TNF-α, which forms a non-covalently linked homotrimer in solution. Recombinant Rat TNF-α is a soluble 157 amino acid protein (17.3 kDa) which corresponds to C-terminal extracellular domain of the full length transmembrane protein.

Amino Acid Sequence

MLRSSSQNSSDKPVAHVVANHQAEEQLEWLSQRANALLANGMDLKDNQLVVPADGLYLIYSQVLFKGQGCPDYVLLTHTVSRFAISYQEKVSLLSAIKSPCPKDTPEGAELKPWYEPMYLGGVFQLEKGDLLSAEVNLPKYLDITESGQVYFGVIAL

Source

E. coli

Purity

98%

Biological Activity

The ED50 as determined by the cytolysis of murine L929 cells in the presence of actinomycin D is ≤ 0.05 ng/ml, corresponding to a specific activity of ≥ 2×107 units/mg.

Endotoxin

Endotoxin level is <0.1 ng/μg of protein (<1EU/μg).

Reconstitution

Centrifuge the vial prior to opening. Reconstitute in water to a concentration of 0.1–1.0 mg/ml. Do not vortex. For extended storage, it is recommended to further dilute in a buffer containing a carrier protein (example 0.1% BSA) and store in working aliquots at –20°C to –80°C.

Storage/Expiration

 –20°C

Summary

Research topic

Cytokines and chemokines and related molecules, Energy metabolism and body weight regulation, Animal studies

Summary

TNF-α (17.5 kDa, 157 amino acid) is a non-glycosylated protein that is a potent lymphoid factor, which exerts cytotoxic effects on a wide range of tumor cells and other target cells. It is secreted by macrophages, monocytes, neutrophils, T-cells and NK-cells following their stimulation by bacterial lipopolysaccha­rides. TNF-α has been suggested to play a pro-inflammatory role and has been detected in synovial fluid of patients with rheumatoid arthritis.

Related Products Docs