Select country change
Shopping cart (0 , 0,00 ) Menu Search
Manufactured by BioVendor

TPO Murine E. coli

  • Regulatory status:RUO
  • Type:Recombinant protein
  • Source:E. coli
  • Other names:Thrombopoietin, Megakaryocyte colony-stimulating factor, c-MPL Ligand, MGDF
  • Species:Murine
Please select your region to see available products and prices.
Cat. No. Size Price


RBG20125002 2 µg
RBG20125010 10 µg
RBG20125100 100 μg
PubMed Product Details
Technical Data

Type

Recombinant protein

Description

TPO is a lineage-specific growth factor produced in the liver, kidney and skeletal muscle. It stimulates the proliferation and maturation of megakaryocytes, and promotes increased circulating levels of platelets in vivo. TPO signals through the c-mpl receptor, and acts as an important regulator of circulating platelets. Human and murine TPO exhibit cross-species reactivity. Recombinant Murine TPO is a fully biologically active 174 amino acid polypeptide (18.7 kDa), which contains the erythropoietin-like domain of the full length TPO protein.

Amino Acid Sequence

SPVAPACDPRLLNKLLRDSHLLHSRLSQCPDVDPLSIPVLLPAVDFSLGEWKTQTEQSKAQDILGAVSLLLEGVMAARGQLEPSCLSSLLGQLSGQVRLLLGALQGLLGTQLPLQGRTTAHKDPNALFLSLQQLLRGKVRFLLLVEGPTLCVRRTLPTTAVPSSTSQLLTLNKF

Source

E. coli

Purity

98%

Biological Activity

The ED50 as determined by the dose-dependent stimulation of the proliferation of human MO7e cells was found to be ≤ 1.0 ng/ml, corresponding to a specific activity of ≥ 1×106 units/mg.

Endotoxin

Endotoxin level is <0.1 ng/μg of protein (<1EU/μg).

Reconstitution

Centrifuge the vial prior to opening. Reconstitute in water to a concentration of ≤ 0.5 mg/ml. Slow to dissolve. Do not vortex. For extended storage, it is recommended to further dilute in a buffer containing a carrier protein (example 0.1% BSA) and store in working aliquots at-20°C to –80°C.

Storage/Expiration

 –20°C

Summary

Research topic

Others, Animal studies

Related Products Docs