Select country change
Shopping cart (0 , 0,00 ) Menu Search
Manufactured by BioVendor

TSG Human E. coli

  • Regulatory status:RUO
  • Type:Recombinant protein
  • Source:E. coli
  • Other names:Twisted Gastrulation Protein
  • Species:Human
Please select your region to see available products and prices.
Cat. No. Size Price


RBG10333010 10 µg
RBG10333050 50 µg
RBG10333100 100 μg
PubMed Product Details
Technical Data

Type

Recombinant protein

Description

Twisted Gastrulation Protein (TSG) is a secreted BMP-binding protein that is structurally related to the BMP antagonists Chordin and Noggin. TSG can inhibit BMP activity by binding directly to BMP proteins, and can act either as a BMP-4 agonist or antagonist (depending on the specific biochemical environment) by binding to the BMP-4/Chordin complex. Recombinant Human TSG is a 198 amino acid, 22.2 kDa protein containing the BMP/TGF-β binding portion of the full length TSG protein.

Amino Acid Sequence

CNKALCASDVSKCLIQELCQCRPGEGNCSCCKECMLCLGALWDECCDCVGMCNPRNYSDTPPTSKSTVEELHEPIPSLFRALTEGDTQLNWNIVSFPVAEELSHHENLVSFLETVNQPHHQNVSVPSNNVHAPYSSDKEHMCTVVYFDDCMSIHQCKISCESMGASKYRWFHNACCECIGPECIDYGSKTVKCMNCMF

Source

E. coli

Purity

98%

Biological Activity

Determined by its ability to neutralize BMP-6 induced alkaline phosphatase production by ATDC chondrogenic cells. The expected ED50 for this effect is 2.0 µg/ml of TSG.

Endotoxin

Endotoxin level is <0.1 ng/μg of protein (<1EU/μg).

Reconstitution

Centrifuge the vial prior to opening. Reconstitute in water to a concentration of 0.1–1.0 mg/ml. Do not vortex. For extended storage, it is recommended to further dilute in a buffer containing a carrier protein (example 0.1% BSA) and store in working aliquots at –20°C to –80°C.

Storage/Expiration

 –20°C

Summary

Research topic

Bone and cartilage metabolism

Related Products Docs