Select country change
Shopping cart (0 , 0,00 ) Menu Search
Manufactured by BioVendor

TSLP Human E. coli

  • Regulatory status:RUO
  • Type:Recombinant protein
  • Source:E. coli
  • Other names:Thymic Stromal Lymphopoietin
  • Species:Human
Please select your region to see available products and prices.
Cat. No. Size Price


RBG10334002 2 µg
RBG10334010 10 µg
RBG10334100 100 μg
PubMed Product Details
Technical Data

Type

Recombinant protein

Description

TSLP is a hemopoietic protein that is expressed in the heart, liver and prostate. TSLP overlaps biological activities with IL-7, and binds with the heterodimeric receptor complex consisting of the IL-7R α-chain (IL-7Rα) and the TSLP-specific chain (TSLPR). Like IL-7, TSLP induces phosphorylation of STAT3 and STAT5, but uses kinases other than the JAKs for activation. TSLP prohibits apoptosis and stimulates growth of the human acute myeloid leukemia (AML)-derived cell line MUTZ3. It induces the release of T cell-attracting chemokines TARC and MDC from monocytes, and activates CD11c(+) dendritic cells (DCs). TSLP-activated DCs have been shown to prime naïve T cells to produce the proallergic cytokines (IL-4, IL-5, IL-13, TNF-α) while down-regulating IL-10 and IFN-γ, suggesting a role in initiating allergic inflammation. Recombinant Human TSLP is a 15.0 kDa protein consisting of 132 amino acid residues.

Amino Acid Sequence

MYDFTNCDFEKIKAAYLSTISKDLITYMSGTKSTEFNNTVSCSNRPHCLTEIQSLTFNPTAGCASLAKEMFAMKTKAALAIWCPGYSETQINATQAMKKRRKRKVTTNKCLEQVSQLQGLWRRFNRPLLKQQ

Source

E. coli

Purity

98%

Biological Activity

Data not available.

Endotoxin

Endotoxin level is <0.1 ng/μg of protein (<1EU/μg).

Reconstitution

Centrifuge the vial prior to opening. Reconstitute in water to a concentration of 0.1–1.0 mg/ml. Do not vortex. For extended storage, it is recommended to further dilute in a buffer containing a carrier protein (example 0.1% BSA) and store in working aliquots at –20°C to –80°C.

Storage/Expiration

 –20°C

Summary

Research topic

Apoptosis

Related Products Docs