Type
Recombinant protein
Description
TSLP is a hemopoietic protein that is expressed in the heart, liver and prostate. TSLP overlaps biological activities with IL-7, and binds with the heterodimeric receptor complex consisting of the IL-7R α-chain (IL-7Rα) and the TSLP-specific chain (TSLPR). Like IL-7, TSLP induces phosphorylation of STAT3 and STAT5, but uses kinases other than the JAKs for activation. TSLP prohibits apoptosis and stimulates growth of the human acute myeloid leukemia (AML)-derived cell line MUTZ3. It induces the release of T cell-attracting chemokines TARC and MDC from monocytes, and activates CD11c(+) dendritic cells (DCs). TSLP-activated DCs have been shown to prime naïve T cells to produce the proallergic cytokines (IL-4, IL-5, IL-13, TNF-α) while down-regulating IL-10 and IFN-γ, suggesting a role in initiating allergic inflammation. Recombinant Human TSLP is a 15.0 kDa protein consisting of 132 amino acid residues.
Amino Acid Sequence
MYDFTNCDFEKIKAAYLSTISKDLITYMSGTKSTEFNNTVSCSNRPHCLTEIQSLTFNPTAGCASLAKEMFAMKTKAALAIWCPGYSETQINATQAMKKRRKRKVTTNKCLEQVSQLQGLWRRFNRPLLKQQ
Source
E. coli
Purity
98%
Biological Activity
Data not available.
Endotoxin
Endotoxin level is <0.1 ng/μg of protein (<1EU/μg).
Reconstitution
Centrifuge the vial prior to opening. Reconstitute in water to a concentration of 0.1–1.0 mg/ml. Do not vortex. For extended storage, it is recommended to further dilute in a buffer containing a carrier protein (example 0.1% BSA) and store in working aliquots at –20°C to –80°C.
Storage/Expiration
–20°C