Select country change
Shopping cart (0 , 0,00 ) Menu Search
Manufactured by BioVendor

Tubulin Polymerization-Promoting Protein Human E. coli

  • Regulatory status:RUO
  • Type:Recombinant protein
  • Source:E. coli
  • Other names:TPPP, 25 kDa brain-specific protein, TPPP/p25, p24, p25-alpha, TPPP1
  • Species:Human
Please select your region to see available products and prices.
Cat. No. Size Price


RD172310100 0.1 mg
PubMed Product Details
Technical Data

Type

Recombinant protein

Description

Total 229 AA. MW: 24.9 kDa (calculated). N-Terminal His-tag (10 extra AA). UniprotKB acc.no. O94811. Protein identity confirmed by LC-MS/MS.

Amino Acid Sequence

MKHHHHHHASMADKAKPAKAANRTPPKSPGDPSKDRAAKRLSLESEGAGEGAAASPELSALEEAFRRFAVHGDARATGREMHGKNWSKLCKDCQVIDGRNVTVTDVDIVFSKIKGKSCRTITFEQFQEALEELAKKRFKDKSSEEAVREVHRLIEGKAPIISGVTKAISSPTVSRLTDTTKFTGSHKERFDPSGKGKGKAGRVDLVDESGYVSGYKHAGTYDQKVQGGK

Source

E. coli

Purity

Purity as determined by densitometric image analysis: >90%

SDS-PAGE Gel

12% SDS-PAGE separation of Human TPPP:
1. M.W. marker – 97, 66, 45, 31, 21, 14 kDa
2. reduced and boiled sample, 2.5μg / lane
3. non-reduced and non-boiled sample, 2.5μg / lane

Endotoxin

< 0.1 EU/μg

Formulation

Filtered (0.4 μm) and lyophilized from 0.5 mg/ml solution in phosphate buffered saline pH 7.4

Reconstitution

Add 200ul of deionized water to prepare a working stock solution of 0.5 mg/mL and let the lyophilized pellet dissolve completely. Product is not sterile! Please filter the product by an appropriate sterile filter before using it in the cell culture.

Applications

Western blotting, ELISA

Shipping

At ambient temperature. Upon receipt, store the product at the temperature recommended below.

Storage/Expiration

Store the lyophilized protein at –80 °C. Lyophilized protein remains stable until the expiry date when stored at –80 °C. Aliquot reconstituted protein to avoid repeated freezing/thawing cycles and store at –80 °C for long term storage. Reconstituted protein can be stored at 4 °C for a week.

Quality Control Test

BCA to determine quantity of the protein.

SDS PAGE to determine purity of the protein.

LAL to determine quantity of endotoxin.

Note

This product is intended for research use only.

Summary

Research topic

Neural tissue markers

Summary

TPPP protein probably participates in the polymerization of tubulin into microtubules. The level of TPPP/p235 in cerebrospinal fluid is significantly higher in multiple sclerosis patients.

Related Products Docs