Select country change
Shopping cart (0 , 0,00 ) Menu Search
Manufactured by BioVendor

Tumor Necrosis Factor Ligand Superfamily Member 12 Human E. coli

  • Regulatory status:RUO
  • Type:Recombinant
  • Source:E. coli
  • Other names:APO3 ligand, TNF-related weak inducer of apoptosis, TWEAK, TNFSF12, APO3L, DR3LG
  • Species:Human
Please select your region to see available products and prices.
Cat. No. Size Price


New RD172148100-E.coli 0.1 mg
PubMed Product Details
Technical Data

Type

Recombinant

Description

Total 162 AA. MW: 18.0 kDa (calculated). UniProtKB acc. no. O43508 (Ser94-His249). C-terminal His-tag (5 extra AA). Protein identity confirmed by LC-MS/MS.

Amino Acid Sequence

MSAPKGRKTRARRAIAAHYEVHPRPGQDGAQAGVDGTVSGWEEARINSSSPLRYNRQIGEFIVTRAGLYYLYCQVHFDEGKAVYLKLDLLVDGVLALRCLEEFSATAASSLGPQLRLCQVSGLLALRPGSSLRIRTLPWAHLKAAPFLTYFGLFQVHHHHHH

Source

E. coli

Purity

Purity as determined by densitometric image analysis: > 95 %

SDS-PAGE Gel

14 % SDS-PAGE separation of Human TWEAK:
1. M.W. marker – 14, 21, 31, 45, 66, 97 kDa
2. Reduced and boiled sample, 2.5 μg/lane
3. Non-reduced and non-boiled sample, 2.5 μg/lane

Endotoxin

< 1.0 EU/μg

Formulation

Filtered (0.4 μm) andand frozen from 0.30 – 0.60 mg/mL in 20 mM Tris buffer, 900 mM NaCl, 20% vol/vol glycerol, pH 7.5.

Reconstitution

Defrost at ambient temperature.Filter sterilize your culture media/working solutions containing this non-sterile product before using in cell culture.

Applications

Western blotting, ELISA

Shipping

On ice. Upon receipt, store the product at the temperature recommended below.

Storage/Expiration

Store the protein at –80 °C. Frozed protein remains stable until the expiry date when stored at –80 °C. Aliquot reconstituted protein to avoid repeated freezing/thawing cycles and store at –80 °C for long term storage. Thawed protein can be stored at 4 °C for a week.

Note

This product is intended for research use only.

Related Products Documents