Select country change
Shopping cart (0 , 0,00 ) Menu Search
Manufactured by BioVendor

TWEAK Human E. coli

  • Regulatory status:RUO
  • Type:Recombinant protein
  • Source:E. coli
  • Other names:Tumor necrosis factor ligand superfamily member 12, TNF-related weak inducer of apoptosis, APO3 ligand, TNFSF12, DR3LG
  • Species:Human
Please select your region to see available products and prices.
Cat. No. Size Price


RBG10335005 5 µg
RBG10335025 25 µg
RBG10335100 100 μg
PubMed Product Details
Technical Data

Type

Recombinant protein

Description

TWEAK belongs to the TNF family of ligands, and signals through TWEAKR, also known as TNFRSF12A. TWEAK is expressed in a variety of tissues, including the adult heart, pancreas, skeletal muscle, small intestine, spleen and peripheral blood lymphocytes. TWEAK has the ability to induce NF-κB activation and chemokine secretion, and to exert an apoptotic activity in certain cells, such as HT-29 human adenocarcinoma cells when cultured in the presence of IFN-γ. TWEAK also promotes proliferation and migration of endothelial cells. The human TWEAK gene encodes for a 249 amino acid type II transmembrane protein, which contains a 21 amino acid cytoplasmic domain, a 21 amino acid transmembrane domain, and a 207 amino acid extracellular domain. Recombinant Human TWEAK is a soluble 17.0 kDa polypeptide (154 amino acid residues) comprising the TNF-homologous region of TWEAK, and is generated by proteolytic processing of the full length membrane-anchored TWEAK protein.

Amino Acid Sequence

MKGRKTRARRAIAAHYEVHPRPGQDGAQAGVDGTVSGWEEARINSSSPLRYNRQIGEFIVTRAGLYYLYCQVHFDEGKAVYLKLDLLVDGVLALRCLEEFSATAASSLGPQLRLCQVSGLLALRPGSSLRIRTLPWAHLKAAPFLTYFGLFQVH

Source

E. coli

Purity

98%

Biological Activity

Assay #1: The ED50 as determined by the dose-dependent stimulation of IL-8 production by Human PBMC is less than 10 ng/ml. Assay #2: TWEAK weakly induces the death of HT29 cells when cultured in the presence of IFN-ɣ. The ED50 for this effect is between 30–45 ng/ml.

Endotoxin

Endotoxin level is <0.1 ng/μg of protein (<1EU/μg).

Reconstitution

Centrifuge the vial prior to opening. Reconstitute in 10 mM Sodium Phosphate, pH 7.5 to a concentration of 1.0 mg/ml. Do not vortex. For extended storage, it is recommended to further dilute in a buffer containing a carrier protein (example 0.1% BSA) and store in working aliquots at-20°C to –80°C.

Storage/Expiration

 –20°C

Related Products Docs