Select country set
language
Menu Shopping cart 0,00 Search
Manufactured by BioVendor

TWEAK Receptor Human E. coli

  • Regulatory status:RUO
  • Type:Recombinant protein
  • Source:E. coli
  • Other names:TNF-related weak inducer of apoptosis receptor, TNFRSF12A, FGF-inducible 14
  • Species:Human
Please select your region to see available products and prices.
Cat. No. Size Price


RBG10336005 5 µg
RBG10336025 25 µg
RBG10336100 100 μg
PubMed Product Details
Technical Data

Type

Recombinant protein

Description

TWEAKR belongs to the TNF family of transmembrane proteins, and contains a cytoplasmic “death domain”, which can activate a cell's apoptotic machinery. It is expressed in the spleen, thymus, peripheral blood lymphocytes, colon, and small intestine. Signal transduction by TWEAKR can be activated by either membrane-anchored or soluble TWEAK. Recombinant Human soluble TWEAKR is a 53 amino acid polypeptide (5.6 kDa) comprising the entire extracellular domain of the full-length TWEAKR protein.

Amino Acid Sequence

EQAPGTAPCSRGSSWSADLDKCMDCASCRARPHSDFCLGCAAAPPAPFRLLWP

Source

E. coli

Purity

98%

Biological Activity

Determined by its ability to inhibit TWEAK-induced weak cell death of HT29 cells. The expected ED50 for this effect is 1.0–3.0 µg/ml.

Endotoxin

Endotoxin level is <0.1 ng/μg of protein (<1EU/μg).

Reconstitution

Centrifuge the vial prior to opening. Reconstitute in water to a concentration of 0.1–1.0 mg/ml. Do not vortex. For extended storage, it is recommended to further dilute in a buffer containing a carrier protein (example 0.1% BSA) and store in working aliquots at –20°C to –80°C.

Storage/Expiration

 –20°C

Summary

Research topic

Others

Related Products Docs