Select country set
language
Menu Shopping cart 0,00 Search
Manufactured by BioVendor

VEGF-C Human HEK293 cells

  • Regulatory status:RUO
  • Type:Recombinant protein
  • Source:HEK293 cells
  • Other names:Vascular endothelial growth factor C, Flt4 ligand
  • Species:Human
Please select your region to see available products and prices.
Cat. No. Size Price


RBG10344005 5 µg
RBG10344020 20 µg
RBG10344100 100 μg
PubMed Product Details
Technical Data

Type

Recombinant protein

Description

VEGF-C, a member of the VEGF/PDGF family of structurally related proteins, is a potent angiogenic cytokine. It promotes endothelial cell growth, promotes lymphangiogesis, and can also affect vascular permeability. VEGF-C is expressed in various tissues, but is not produced in peripheral blood lymphocytes. It forms cell surfaced-associated, non-covalent, disulfide-linked homodimers, and can bind and activate both VEGFR-2 (flk1) and VEGFR-3 (flt4) receptors. During embryogenesis, VEGF-C may play a role in the formation of the venous and lymphatic vascular systems. Both VEGF-C and VEGF-D are over-expressed in certain cancers, and the resulting elevated levels of VEGF-C or VEGF-D tend to correlate with increased lymphatic metastasis. Recombinant Human VEGF-C is a non-disulfide-linked homodimeric protein consisting of two 13.5 kDa polypeptide chains of 116 amino acid residues. Due to glycosylation, the protein migrates as a 20.0–22.0 kDa band by SDS-PAGE analysis under non-reducing conditions.

Amino Acid Sequence

MAHYNTEILKSIDNEWRKTQCMPREVCIDVGKEFGVATNTFFKPPCVSVYRCGGCCNSEGLQCMNTSTSYLSKTLFEITVPLSQGPKPVTISFANHTSCRCMSKLDVYRQVHSIIRR

Source

HEK293 cells

Purity

95%

Biological Activity

Determined by its ability to support rat Retinal Ganglion Cells (RGC-5) cell growth in low serum media.

Endotoxin

Endotoxin level is <0.1 ng/μg of protein (<1EU/μg).

Reconstitution

Centrifuge the vial prior to opening. Reconstitute in water to a concentration of 0.1–1.0 mg/ml. Do not vortex. For extended storage, it is recommended to further dilute in a buffer containing a carrier protein (example 0.1% BSA) and store in working aliquots at –20°C to –80°C.

Storage/Expiration

 –20°C

Summary

Research topic

Cytokines and chemokines and related molecules

Summary

Vascular endothelial growth factor-C (VEGF-C) is a member of the VEGF family of cytokines. It has been shown to exhibit angiogenic and lymphangiogenic actions. The VEGF family of growth factors and receptors is involved in the development and growth of the vascular endothelial system. Two of its family members, VEGF-C and VEGF-D, regulate the lymphatic endothelial cells via their receptor VEGFR3, thus acting as mitogens for these cells. VEGF-C expression is associated with hematological malignancies. Like VEGF it acts as survival factor on leukemia. Together with the expression of their receptors, VEGF and VEGF-C result in the generation of autocrine loops that may support cancer cell survival and proliferation. Further VEGF-C expression has been shown in gastrointestinal tract malignancies where it correlates with lymphatic invasion, lymphnode metastasis and reduced survival.

Related Products Docs