Select country change
Shopping cart (0 , 0,00 ) Menu Search
Manufactured by BioVendor

Viral MIP-2 E. coli

  • Regulatory status:RUO
  • Type:Recombinant protein
  • Source:E. coli
  • Other names:Macrophage inflammatory Protein-2, Viral Macrophage inflammatory Protein-2
Please select your region to see available products and prices.
Cat. No. Size Price


RBG40004010 10 µg
RBG40004050 50 µg
RBG40004100 100 μg
PubMed Product Details
Technical Data

Type

Recombinant protein

Description

Viral MIP-2 (vMIP-2) is a chemokine analog encoded by the human herpes virus, and has been shown to have antagonist activity towards several chemokine receptors. Recombinant Viral MIP-2 is a 7.9 kDa protein consisting of 70 amino acids, including the four highly conserved cysteine residues present in CC chemokines.

Amino Acid Sequence

LGASWHRPDKCCLGYQKRPLPQVLLSSWYPTSQLCSKPGVIFLTKRGRQVCADKSKDWVKKLMQQLPVTA

Source

E. coli

Purity

98%

Biological Activity

Determined by the inhibitory effect on monocyte migration response to human MIP-1 alpha using a concentration range of 1.0µg-10.0µg/ml of viral MIP-2 will inhibit 25ng/ml of human MIP-1 alpha.

Endotoxin

Endotoxin level is <0.1 ng/μg of protein (<1EU/μg).

Reconstitution

Centrifuge the vial prior to opening. Reconstitute in water to a concentration of 0.1–1.0 mg/ml. Do not vortex. For extended storage, it is recommended to further dilute in a buffer containing a carrier protein (example 0.1% BSA) and store in working aliquots at –20°C to –80°C.

Storage/Expiration

 –20°C

Summary

Research topic

Chemokines

Related Products Docs