Select country change
Shopping cart (0 , 0,00 ) Menu Search
Manufactured by BioVendor

Vitronectin Human HEK293 cells

  • Regulatory status:RUO
  • Type:Recombinant protein
  • Source:HEK293 cells
  • Species:Human
Please select your region to see available products and prices.
Cat. No. Size Price


RBG103480100 100 μg
RBG103481000 1mg
RBG103480500 500 μg
PubMed Product Details
Technical Data

Type

Recombinant protein

Amino Acid Sequence

DQESCKGRCTEGFNVDKKCQCDELCSYYQSCCTDYTAECKPQVTRGDVFTMPEDEYTVYDDGEEKNNATVHEQVGGPSLTSDLQAQSKGNPEQTPVLKPEEEAPAPEVGASKPEGIDSRPETLHPGRPQPPAEEELCSGKPFDAFTDLKNGSLFAFRGQYCYELDEKAVRPGYPKLIRDVWGIEGPIDAAFTRINCQGKTYLFKGSQYWRFEDGVLDPDYPRNISDGFDGIPDNVDAALALPAHSYSGRERVYFFKGKQYWEYQFQHQPSQEECEGSSLSAVFEHFAMMQRDSWEDIFELLFWGRTSAGTRQPQFISRDWHGVPGQVDAAMAGRIYISGMAPRPSLAKKQRFRHRNRKGYRSQRGHSRGRNQNSRRPSRATWLSLFSSEESNLGANNYDDYRMDWLVPATCEPIQSVFFFSGDKYYRVNLRTRRVDTVDPPYPRSIAQYWLGCPAPGHL

Source

HEK293 cells

Purity

95%

Biological Activity

Data not available.

Endotoxin

Endotoxin level is <0.1 ng/μg of protein (<1EU/μg).

Reconstitution

Centrifuge the vial prior to opening. Reconstitute in water to a concentration of 0.1–1.0 mg/ml. Do not vortex. For extended storage, it is recommended to further dilute in a buffer containing a carrier protein (example 0.1% BSA) and store in working aliquots at-20°C to –80°C.

Storage/Expiration

 –20°C

Summary

Summary

Vitronectin is an 75 kDa glycoprotein consisting of 459 amino acid residues. It is abundant in blood plasma and the extracellular matrix. Vitronectin contains three glycosylation sites that contribute approximately 30% of its molecular mass. It circulates as a singlechain (75 kDa) and two-chain (10 and 65 kDa) forms under reducing conditions. Under non-reducing conditions, the Nterminal 65 kDa and C-terminal 10 kDa fragments are linked by a single disulfide bond . Vitronectin has been implicated as a regulator of many diverse physiological processes including coagulation, fibrinolysis, pericellular proteolysis, complement dependent immune response, cell attachment and spreading. Cell adhesion and migration are directly involved in cancer metastasis and tumor malignancy. The Somatomedin B domain of Vitronectin binds to Plasminogen activator inhibitor-1 (PAI-1), and stabilizes it. Thus vitronectin serves to regulate proteolysis initiated by plasminogen activation. Additionally vitronectin is a component of platelets and is thus involved in hemostasis via heparin binding which neutralizing antithrombin III inhibition of thrombin and factor Xa. Vitronectin contains an RGD (45–47) sequence which is a binding site for membrane bound integrins, which serve to anchor cells to the extracellular matrix.

Related Products Docs