Select country change
Shopping cart (0 , 0,00 ) Menu Search
Manufactured by BioVendor

WNT-1 Human E. coli

  • Regulatory status:RUO
  • Type:Recombinant protein
  • Source:E. coli
  • Other names:INT-1
  • Species:Human
Please select your region to see available products and prices.
Cat. No. Size Price


RBG10351002 2 µg
RBG10351010 10 ug
RBG10351100 100 μg
PubMed Product Details
Technical Data

Type

Recombinant protein

Description

Wnt-1 is a secreted protein that signals through the Frizzled family of cell surface receptors, and is required for normal embryonic development. Wnt-1 activation induces a complex signaling cascade that ultimately leads to the increased expression of over fifty genes. An important component of Wnt-1 signaling is the stabilization, and resulting accumulation, of the intracellular signaling protein, β-catenin. Wnt signaling induces and maintains the transformed phenotype, and, in certain embryonic cell lines, supports self-renewal in the absence of significant differentiation. Elevated levels of Wnt proteins are associated with tumorigenesis, and are present in numerous human breast cancers. Mature human Wnt-1 is a glycosylated protein containing 343 amino acid residues. Recombinant Human Wnt-1 is a 38.4 kDa, non-glycosylated protein containing 343 amino acid residues.

Amino Acid Sequence

ANSSGRWWGIVNVASSTNLLTDSKSLQLVLEPSLQLLSRKQRRLIRQNPGILHSVSGGLQSAVRECKWQFRNRRWNCPTAPGPHLFGKIVNRGCRETAFIFAITSAGVTHSVARSCSEGSIESCTCDYRRRGPGGPDWHWGGCSDNIDFGRLFGREFVDSGEKGRDLRFLMNLHNNEAGRTTVFSEMRQECKCHGMSGSCTVRTCWMRLPTLRAVGDVLRDRFDGASRVLYGNRGSNRASRAELLRLEPEDPAHKPPSPHDLVYFEKSPNFCTYSGRLGTAGTAGRACNSSSPALDGCELLCCGRGHRTRTQRVTERCNCTFHWCCHVSCRNCTHTRVLHECL

Source

E. coli

Purity

98%

Biological Activity

The ED50 was determined by its ability to enhance BMP-2 induced alkaline phosphatase production by murine ATDC5 cells. The expected ED50 for this effect is 1.5 – 2.5 ng/ml in the presence of 200 ng/ml of human BMP-2.

Storage/Expiration

 –20°C

Summary

Research topic

Immune Response, Infection and Inflammation, Oncology

Related Products Docs