Select country change
Shopping cart (0 , 0,00 ) Menu Search
Manufactured by BioVendor

Xylosyltransferase 2 Human HEK293

  • Regulatory status:RUO
  • Type:Recombinant
  • Source:HEK293
  • Other names:Peptide O-xylosyltransferase 1, Xylosyltransferase II, XT-II, XylT-II, UDP-D-xylose:proteoglycan core protein beta-D-xylosyltransferase
  • Species:Human
Please select your region to see available products and prices.
Cat. No. Size Price


New RD172125100 0.1 mg
RD172125025 0.025 mg
PubMed Product Details
Technical Data

Type

Recombinant

Description

Total 839 AA. MW: 94.0 kDa (calculated). UniProtKB acc. No. Q9H1B5 (Gly37-Arg865, lumenal domain, isoform 1, natural variant with Thr305). N-terminal linker (2 extra AA), C-terminal linker (2 extra AA) and C-terminal His-tag (6 extra AA). Protein identity confirmed by LC-MS/MS.

Amino Acid Sequence

ASGLEEDEAGEKGRQRKPRPLDPGEGSKDTDSSAGRRGSTGRRHGRWRGRAESPGVPVAKVVRAVTSRQRASRRVPPAPPPEAPGRQNLSGAAAGEALVGAAGFPPHGDTGSVEGAPQPTDNGFTPKCEIVGKDALSALARASTKQCQQEIANVVCLHQAGSLMPKAVPRHCQLTGKMSPGIQWDESQAQQPMDGPPVRIAYMLVVHGRAIRQLKRLLKAVYHEQHFFYIHVDKRSDYLHREVVELAQGYDNVRVTPWRMVTIWGGASLLTMYLRSMRDLLEVPGWAWDFFINLSATDYPTRTNEELVAFLSKNRDKNFLKSHGRDNSRFIKKQGLDRLFHECDSHMWRLGERQIPAGIVVDGGSDWFVLTRSFVEYVVYTDDPLVAQLRQFYTYTLLPAESFFHTVLENSLACETLVDNNLRVTNWNRKLGCKCQYKHIVDWCGCSPNDFKPQDFLRLQQVSRPTFFARKFESTVNQEVLEILDFHLYGSYPPGTPALKAYWENTYDAADGPSGLSDVMLTAYTAFARLSLHHAATAAPPMGTPLCRFEPRGLPSSVHLYFYDDHFQGYLVTQAVQPSAQGPAETLEMWLMPQGSLKLLGRSDQASRLQSLEVGTDWDPKERLFRNFGGLLGPLDEPVAVQRWARGPNLTATVVWIDPTYVVATSYDITVDTETEVTQYKPPLSRPLRPGPWTVRLLQFWEPLGETRFLVLPLTFNRKLPLRKDDASWLHAGPPHNEYMEQSFQGLSSILNLPQPELAEEAAQRHTQLTGPALEAWTDRELSSFWSVAGLCAIGPSPCPSLEPCRLTSWSSLSPDPKSELGPVKADGRLRKLHHHHHH

Source

HEK293

Purity

Purity as determined by densitometric image analysis: >95%

SDS-PAGE Gel

14 % SDS-PAGE separation of Human Xylosyltransferase 2:
1. MW marker – 14, 21, 31, 45, 66, 97 kDa
2. reduced and boiled sample, 2.5 μg/lane
3. non-reduced and non-boiled sample, 2.5 μg/lane

Endotoxin

< 0.1 EU/ug

Formulation

Filtered (0.4 μm) and lyophilized in 0.05 M phosphate buffer, 0.075 M NaCl, pH 7.4

Reconstitution

Add deionized water to prepare a working stock solution of approximately 0.5 mg/ml and let the lyophilized pellet dissolve completely. Product is not sterile! Filter your culture media/working solutions containing this product before using in cell culture.

Applications

Western blotting, ELISA, Cell culture and/or animal studies

Shipping

At ambient temperature. Upon receipt, store the product at the temperature recommended below.

Storage/Expiration

Store the lyophilized protein at –80 °C. Lyophilized protein remains stable until the expiry date when stored at –80 °C. Aliquot reconstituted protein to avoid repeated freezing/thawing cycles and store at –80 °C for long term storage. Reconstituted protein can be stored at 4 °C for three days.

Quality Control Test

BCA to determine quantity of the protein.

SDS PAGE to determine purity of the protein.

LAL to determine quantity of endotoxin.

Note

This product is intended for research use only.

Summary

Summary

Xylosyltransferases (XTs) are ubiquitously expressed enzymes that belong to the group of glycosyltransfe­rases. These enzymes initiate the proteoglycans formation by assembly of glycosaminoglycan (GAG) chains to the protein substrate by catalysing the transfer of xylose from the nucleoside diphosphate donor (UDP-xylose) to serine residues in the protein [1, 2]. XTs reside in the endoplasmatic reticulum and/or cis-Golgi, but they are also released into extracellular matrix [3]. The XTs serum activity has been proposed as biomarker of altered proteoglycan metabolism in various diseases, eg. diabetes, systematic sclerosis, liver neoplasia and HTLV-1 retrovirus adhesion [4].

References to Summary

References to Xylosyltransferase 2

  • Condac E, Dale GL, Bender-Neal D, Ferencz B, Towner R, Hinsdale ME. Xylosyltransferase II is a significant contributor of circulating xylosyltransferase levels and platelets constitute an important source of xylosyltransferase in serum. Glycobiology. 2009 Aug;19 (8):829-33
  • Gotting C, Kuhn J, Brinkmann T, Kleesiek K. Xylosylation of alternatively spliced isoforms of Alzheimer APP by xylosyltransferase. J Protein Chem. 1998 Apr;17 (3):295-302
  • Ponighaus C, Ambrosius M, Casanova JC, Prante C, Kuhn J, Esko JD, Kleesiek K, Gotting C. Human xylosyltransferase II is involved in the biosynthesis of the uniform tetrasaccharide linkage region in chondroitin sulfate and heparan sulfate proteoglycans. J Biol Chem. 2007 Feb 23;282 (8):5201-6
Related Products