Type
Recombinant protein
Description
Total 161 AA. MW: 17.9 kDa (calculated). UniProtKB acc.no. O60844. N-Terminal His-tag (10 extra AA)
Amino Acid Sequence
MKHHHHHHASNAIQARSSSYSGEYGSGGGKRFSHSGNQLDGPITALRVRVNTYYIVGLQVRYGKVWSDYVGGRNGDLEEIFLHPGESVIQVSGKYKWYLKKLVFVTDKGRYLSFGKDSGTSFNAVPLHPNTVLRFISGRSGSLIDAIGLHWDVYPTSCSRC
Source
E. coli
Purity
Purity as determined by densitometric image analysis: >95%
SDS-PAGE Gel
14% SDS-PAGE separation of Human ZG16
1. M.W. marker – 97, 66, 45, 31, 21, 14 kDa
2. reduced and boiled sample, 5μg/lane
3. non-reduced and non-boiled sample, 5μg/lane
Endotoxin
<1.0 EU/ug
Formulation
Filtered (0,4 μm) and lyophilized in 0.5 mg/mL in 0.05 M phosphate buffer, 0.075 M NaCl, pH 7.4
Reconstitution
Add deionized water to prepare a working stock solution of approximately 0.5 mg/mL and let the lyophilized pellet dissolve completely. Filter sterilize your culture media/working solutions containing this non-sterile product before using in cell culture.
Applications
Western blotting, ELISA
Shipping
At ambient temperature. Upon receipt, store the product at the temperature recommended below.
Storage/Expiration
Store lyophilized protein at –80°C. Lyophilized protein remains stable until the expiry date when stored at –80°C. Aliquot reconstituted protein to avoid repeated freezing/thawing cycles and store at –80°C for long term storage. Reconstituted protein can be stored at 4°C for a week.
Quality Control Test
BCA to determine quantity of the protein.
SDS PAGE to determine purity of the protein.
LAL to determine quantity of endotoxin.
Research topic
Oncology, Others
Summary
Zymogen granule membrane protein 16 (ZG16) is a 16 kDa protein first identified by immunoscreening of a rat pancreatic cDNA expression library with a polyspecific antiserum raised against purified zymogen granule membranes (ZGM). ZG16 displays sequence homology especially in the carbohydrate recognition domain to the plant lectin jacalin, which recognizes terminal galactose attached to N-acetylgalactosamine by a β1–3 linkage. According to its sequence homology with this lectin, ZG16 was considered a secretory lectin ZG16. Sequence analyses uncovered that ZG16 is highly conserved amongst mammals but also appears in many other species. Rat ZG16 was found to be highly expressed in pancreas, colon, and duodenum, where the protein was localized in the zymogen granule of pancreas. The previous reports indicated that rat ZG16 took part in the formation of zymogen granule by mediating the digested enzymes to the zymogen granule membrane in pancreatic acinar cells. Human ZG16 was shown to be highly expressed in adult liver and moderately expressed in intestine (jejunum, ileum) and colon. Moreover, ZG16 is also weakly expressed in pedunculus cerebellaris but not in other brain’s regions. Owing to the specific expression pattern in human liver, ZG16 was evaluated in hepatocellular carcinoma (HCC), a common cancer worldwide (it was found that human ZG16 was significantly down-regulated in HCC). ZG16 protein took part also in several secretions of glycoproteins (the secretion of human ZG16 would be affected when the synthesis of glycans was inhibited with inhibitor or without glucose in cell culture).