Select country change
Shopping cart (0 , 0,00 ) Menu Search
Manufactured by BioVendor

Beta-Microseminoprotein Human E. coli

  • Regulatory status:RUO
  • Type:Recombinant protein
  • Source:E. coli
  • Other names:Prostate secretory protein PSP94, Prostate secreted seminal plasma protein, Prostate secretory protein of 94 amino acids, PSP-94, Seminal plasma beta-inhibin, Immunoglobulin-binding factor, IGBF, PN44, MSMB, PRSP
  • Species:Human
Please select your region to see available products and prices.
Cat. No. Size Price


RD172140100 0.1 mg
PubMed Product Details
Technical Data

Type

Recombinant protein

Description

Total 104 AA. MW: 12.01 kDa (calculated). UniProtKB acc.no. P08118. N-terminal His-tag, 10extra AA (highlighted).

Amino Acid Sequence

MKHHHHHHASSCYFIPNEGVPGDSTRKCMDLKGNKHPINSEWQTDNCETCTCYETEISCCTLVSTPVGYDKDNCQRIFKKEDCKYIVVEKKDPKKTCSVSEWII

Source

E. coli

Purity

>95%

SDS-PAGE Gel

12% SDS-PAGE separation of Human PSP 94
1. M.W. marker – 14, 21, 31, 45, 66, 97 kDa
2. reduced and heated sample, 5μg / lane
3. non-reduced and non-heated sample, 5μg / lane

Formulation

Filtered (0.4 μm) and lyophilized from 0.5 mg/ml in 20mM Tris buffer, 20mM NaCl, pH 7.5

Reconstitution

Add deionized water to prepare a working stock solution of approximately 0.5 mg/mL and let the lyophilized pellet dissolve completely. Filter sterilize your culture media/working solutions containing this non-sterile product before using in cell culture.

Applications

Western blotting

Shipping

At ambient temperature. Upon receipt, store the product at the temperature recommended below.

Storage/Expiration

Store the lyophilized protein at –80 °C. Lyophilized protein remains stable until the expiry date when stored at –80 °C. Aliquot reconstituted protein to avoid repeated freezing/thawing cycles and store at –80 °C for long term storage. Reconstituted protein can be stored at 4 °C for a week.

Quality Control Test

BCA to determine quantity of the protein.

SDS PAGE to determine purity of the protein.

Note

This product is intended for research use only.

Summary

Research topic

Oncology

Related Products Docs