Select country change
Shopping cart (0 , 0,00 ) Menu Search
Manufactured by BioVendor

Cell Death-Inducing DFFA-Like Effector C Human E. coli

  • Regulatory status:RUO
  • Type:Recombinant protein
  • Source:E. coli
  • Other names:Cell death activator CIDE-3, Fat-specific protein FSP27 homolog, CIDEC, FSP27
  • Species:Human
Please select your region to see available products and prices.
Cat. No. Size Price


RD172372100 0.1 mg
PubMed Product Details
Technical Data

Type

Recombinant protein

Description

Total 247 AA. MW: 28 kDa (calculated). UniProtKB acc.no. Q96AQ7 (Glu2-Gln238). N-terminal His-tag (10 extra AA). Protein identity confirmed by LC-MS/MS.

Amino Acid Sequence

MKHHHHHHASEYAMKSLSLLYPKSLSRHVSVRTSVVTQQLLSEPSPKAPRARPCRVSTADRSVRKGIMAYSLEDLLLKVRDTLMLADKPFFLVLEEDGTTVETEEYFQALAGDTVFMVLQKGQKWQPPSEQGTRHPLSLSHKPAKKIDVARVTFDLYKLNPQDFIGCLNVKATFYDTYSLSYDLHCCGAKRIMKEAFRWALFSMQATGHVLLGTSCYLQQLLDATEEGQPPKGKASSLIPTCLKILQ

Source

E. coli

Purity

Purity as determined by densitometric image analysis: > 95 %

SDS-PAGE Gel

14 % SDS-PAGE separation of Human Cell Death-Inducing DFFA-Like Effector C:
1. M.W. marker – 14, 21, 31, 45, 66, 97 kDa
2. reduced and boiled sample, 2.5 μg/lane
3. non-reduced and non-boiled sample, 2.5 μg/lane

Endotoxin

< 1.0 EU/ug

Formulation

0.4 – 0.8 mg/ml in 30 mM acetate buffer, 10mM dithiothreitol, pH 4 – filtered (0.4 μm), frozen

Reconstitution

Defrost at ambient temperature. Filter sterilize your culture media/working solutions containing this non-sterile product before using in cell culture.

Applications

Western blotting, ELISA

Shipping

On ice. Upon receipt, store the product at the temperature recommended below.

Storage/Expiration

Store protein at –80°C. Protein remains stable until the expiry date when stored at –80°C. Avoid repeated freezing/thawing cycles. The thawed protein can be stored at 4 °C for a week.

Quality Control Test

Bradford protein assay to determine quantity of the protein.
SDS-PAGE to determine purity of the protein.
LAL TEST to determine endotoxin level.

Note

This product is intended for research use only.

Summary

Research topic

Energy metabolism and body weight regulation, Lipoprotein metabolism

Summary

Cell death activator CIDE-3 regulates enlargement of lipid droplets. It is expressed mainly in adipocytes, intestine, heart, stomach, and weakly in brain, kidney and liver. Its overexpression in preadipocytes induces apoptosis.

Related Products Documents