Select country change
Shopping cart (0 , 0,00 ) Menu Search
Manufactured by BioVendor

CTRP6 Human E. coli

  • Regulatory status:RUO
  • Type:Recombinant protein
  • Source:E. coli
  • Other names:C1QTNF6, CTRP6, UNQ581/PRO1151
  • Species:Human
Please select your region to see available products and prices.
Cat. No. Size Price


RD172156100 0.1 mg
PubMed Product Details
Technical Data

Type

Recombinant protein

Description

Total 242 AA. MW: 27.02 kDa (calculated). UniProtKB acc.no. Q9BXI9. N-terminal His-tag, 10extra AA (highlighted).

Amino Acid Sequence

MKHHHHHHASTFDRAVASGCQRCCDSEDPLDPAHVSSASSSGRPHALPEIRPYINITILKGDKGDPGPMGLPGYMGREGPQGEPGPQGSKGDKGEMGSPGAPCQKRFFAFSVGRKTALHSGEDFQTLLFERVFVNLDGCFDMATGQFAAPLRGIYFFSLNVHSWNYKETYVHIMHNQKEAVILYAQPSERSIMQSQSVMLDLAYGDRVWVRLFKRQRENAIYSNDFDTYITFSGHLIKAEDD

Source

E. coli

Purity

Purity as determined by densitometric image analysis: > 95 %

SDS-PAGE Gel

12% SDS-PAGE separation of Human CTRP6:
1. M.W. marker – 14, 21, 31, 45, 66, 97 kDa
2. non-reduced and non-heated sample, 2.5μg / lane
3. reduced and heated sample, 2.5μg / lane

Endotoxin

< 1.0 EU/ug

Formulation

0.2 – 0.6 mg/ml in 0.03M acetate buffer, 5mM DTT pH=4.0 – filtered (0.4 μm), frozen

Reconstitution

Defrost at ambient temperature.Filter sterilize your culture media/working solutions containing this non-sterile product before using in cell culture.

Applications

Western blotting, ELISA

Shipping

On ice. Upon receipt, store the product at the temperature recommended below.

Storage/Expiration

Store protein at –80°C. Protein remains stable until the expiry date when stored at –80°C. Avoid repeated freezing/thawing cycles.

Quality Control Test

Bradford protein assay to determine quantity of the protein.
SDS-PAGE to determine purity of the protein.
LAL TEST to determine endotoxin level.

Note

This product is intended for research use only.

Summary

Research topic

Energy metabolism and body weight regulation

Related Products Documents