Select country change
Shopping cart (0 , 0,00 ) Menu Search
Manufactured by BioVendor

Glucagon-Like Peptide-1 Receptor Human E. coli

  • Regulatory status:RUO
  • Type:Recombinant protein
  • Source:E. coli
  • Other names:GLP-1 receptor
  • Species:Human
Please select your region to see available products and prices.
Cat. No. Size Price


RD172243100 0.1 mg
PubMed Product Details
Technical Data

Type

Recombinant protein

Description

Recombinant protein contains only the N-terminal extracellular domain. It contains amino acids no. 24–154 of the protein acc.no. P43220 in UniProtKB. Total 132 AA. MW: 15.55 kDa (calculated). N-Terminal His-tag (10 extra AA)

Amino Acid Sequence

MKHHHHHHASRPQGATVSLWETVQKWREYRRQCQRSLTEDPPPATDLFCNRTFDEYACWPDGEPGSFVNVSCPWYLPWASSVPQGHVYRFCTAEGLWLQKDNSSLPWRDLSECEESKRGERSSPEEQLLFLY

Source

E. coli

Purity

Purity as determined by densitometric image analysis: 90 %

SDS-PAGE Gel

14% SDS-PAGE separation of Human GLP-1R
1. M.W. marker – 97, 66, 45, 31, 21, 14 kDa
2. reduced and boiled sample, 5μg/lane
3. non-reduced and non-boiled sample, 5μg/lane

Endotoxin

< 1.0 EU/ug

Formulation

Filtered (0.4 μm) and lyophilized in 0.5 mg/mL in 0.05 M Acetate buffer pH=4.0

Reconstitution

Add 0.1M Acetate buffer pH=4.0 to prepare a working stock solution of approximately 0.5 mg/mL and let the lyophilized pellet dissolve completely at 37°C. For conversion into higher pH value, we recommend intensive dilution by relevant buffer to a concentration of 10μg/mL. In higher concentrations the solubility of this antigen is limited. Filter sterilize your culture media/working solutions containing this non-sterile product before using in cell culture.

Applications

Western blotting

Shipping

At ambient temperature. Upon receipt, store the product at the temperature recommended below.

Storage/Expiration

Store lyophilized protein at –80°C. Lyophilized protein remains stable until the expiry date when stored at –80°C. Aliquot reconstituted protein to avoid repeated freezing/thawing cycles and store at –80°C for long term storage. Reconstituted protein can be stored at 4°C for a week.

Quality Control Test

BCA to determine quantity of the protein.

SDS PAGE to determine purity of the protein.

LAL to determine quantity of endotoxin.

Summary

Research topic

Diabetology - Other Relevant Products, Energy metabolism and body weight regulation

Related Products Documents