Type
Recombinant protein
Description
Granulocyte Colony Stimulating Factor Human Recombinant produced in E.coli is a single, glycosylated, polypeptide chain containing 174 amino acids and having a molecular mass of 20 KD.G-CSF is purified by proprietary chromatographic techniques.
Amino Acid Sequence
TPLGPASSLPQSFLLKCLEQVRKIQGDGAALQEKLCATYKLCHPEELVLLGHSLGIPWAPLSSCPSQALQLAGCLSQLHSGLFLYQGLLQALEGISPELGPTLDTLQLDVADFATTIWQQMEELGMAPALQPTQGAMPAFASAFQRRAGGVLVASHLQSFLEVSYRVLRHLAQP
Source
Chinese Hamster Ovary Cells (CHO)
Purity
Greater than 97.0% as determined by: - Analysis by RP-HPLC. - Analysis by SDS-PAGE.
Biological Activity
The ED50, calculated by the dose-dependant proliferation of murine NFS-60 indicator cells (measured by 3H-thymidine uptake) is < 0.7 ng/ml, corresponding to a Specific Activity of 1.27×108 IU/mg.
Formulation
G-CSF was lyophilized from a concentrated (1mg/ml) solution containing Phosphate-Buffered Saline, pH 7.4
Shipping
At ambient temperature. Upon receipt, store the product at the temperature recommended below.
Storage/Expiration
Lyophilized Granulocyte Colony Stimulating Factor although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution G-CSF should be stored a t 4°C between 2–7 days and for future use below -18°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Please prevent freeze-thaw cycles.
Physical Appearance
Sterile filtered white lyophilized (freeze-dried) powder.