Select country set
language
Menu Shopping cart 0,00 Search
Manufactured by BioVendor

Macrophage Colony Stimulating Factor Mouse E. coli

  • Regulatory status:RUO
  • Type:Recombinant protein
  • Source:E. coli
  • Species:Mouse
Please select your region to see available products and prices.
Cat. No. Size Price


RP1764390002 2 µg
RP1764390010 10 µg
RP1764391000 1 mg
PubMed Product Details
Technical Data

Type

Recombinant protein

Description

Macrophage Colony Stimulating Factor Mouse Recombinant produced in E.coli is a disulfide linked homodimer, non-glycosylated, polypeptide chain containing 2×156 amino acids and having a total molecular mass of 36.4 KD. MCSF is purified by proprietary chromatographic techniques.

Amino Acid Sequence

MKEVSEHCSHMIGNGHLKVLQQLIDSQMETSCQIAFEFVDQEQLDDPVCYLKKAFFLVQDIIDETMRFKDNTPNANATERLQELSNNLNSCFTKDYEEQNKACVRTFHETPLQLLEKIKNFFNETKNLLEKDWNIFTKNCNNSFAKCSSRDVVTKP

Source

E. coli

Purity

Greater than 98.0% as determined by: (a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.

Biological Activity

The ED50, calculated by the dose-dependant stimulation of the proliferation of murine M-NFS-60 indicator cells was found 0.91 ng/ml.

Formulation

The protein (1 mg/ml) was lyophilized with 0.5×PBS, pH 8.0.

Shipping

At ambient temperature. Upon receipt, store the product at the temperature recommended below.

Storage/Expiration

Lyophilized M-CSF although stable at room temperature for 3 weeks, should be stored desiccated below –18°C. Upon reconstitution MCSF should be stored at 4°C between 2–7 days and for future use below –18°C. Please prevent freeze-thaw cycles.

Physical Appearance

Sterile filtered white lyophilized (freeze-dried) powder.

Summary

Research topic

Animal studies

Related Products Docs