Select country set
language
Menu Shopping cart 0,00 Search
Manufactured by BioVendor

CXCL12 (SDF-1α) (Biotinylated) Human E.coli

  • Regulatory status:RUO
  • Type:Recombinant protein
  • Source:E. coli
  • Other names:(SDF-1alpha) Stromal cell-derived factor 1, SDF-1a, C-X-C motif chemokine 12, Pre-B cell growth-stimulating factor, PBSF, hIRH, CXCL12 (isoform alpha)
  • Species:Human
Please select your region to see available products and prices.
Cat. No. Size Price


RD172381002-BIOTIN 0.002 mg
RD172381010-BIOTIN 0.01 mg
RD172381050-BIOTIN 0.05 mg
PubMed Product Details
Technical Data

Type

Recombinant protein

Description

Total 87 AA. MW: 10,4 kDa (calculated).Bi­otinylated at the last Lysine in sequence. UniProtKB acc.no# P48061 2 (24–89) Protein identity confirmed by LC-MS/MS.

Amino Acid Sequence

KPVSLSYRCPCRFFESHVARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALNKKLGSGLNDIFEAQKIEWHE

Source

E. coli

Purity

Purity as determined by SDS PAGE: >97 %

Biological Activity

EC50 = 2.5nM determined by Calcium Flux with human CXCR4 in U937 cells Migration confirmed with U937 cells expressing CXCR4

Endotoxin

<0.01 EU /1µg

Reconstitution

Add sterile water to prepare a working stock solution of approximately 0.1 mg/ml and let the lyophilized pellet dissolve completely.

Applications

Western blotting, ELISA, Cell culture and/or animal studies, Biologically active protein, Immunocytochemistry, Flow cytometry

Shipping

At ambient temperature. Upon receipt, store the product at the temperature recommended below.

Storage/Expiration

Store the lyophilized protein at –20 to –70 °C. Lyophilized protein remains stable until the expiry date when stored at-20 to –70 °C. Aliquot reconstituted protein to avoid repeated freezing/thawing cycles and store at -20 to –70 °C, the protein is stable for 3 months at –20 to –70 °C under sterile conditions after reconstitution. Reconstituted protein can be stored at 4 °C for 1 month under sterile conditions after reconstitution

Quality Control Test

Quantification is done by A280, using the calculated extinction coefficient (14,420 M-1 cm-1).
SDS-PAGE to determine purity of the protein.
LAL TEST to determine endotoxin level.

Note

This product is intended for research use only.

Summary

Research topic

Chemokines, Cytokines and chemokines and related molecules, Immune Response, Infection and Inflammation

Summary

Chemoattractant active on T-lymphocytes, monocytes, but not neutrophils. Activates the C-X-C chemokine receptor CXCR4 to induce a rapid and transient rise in the level of intracellular calcium ions and chemotaxis. Also binds to another C-X-C chemokine receptor CXCR7, which activates the beta-arrestin pathway and acts as a scavenger receptor for SDF-1. SDF-1-beta(3–72) and SDF-1-alpha(3–67) show a reduced chemotactic activity. Binding to cell surface proteoglycans seems to inhibit formation of SDF-1-alpha(3–67) and thus to preserve activity on local sites. Acts as a positive regulator of monocyte migration and a negative regulator of monocyte adhesion via the LYN kinase. Stimulates migration of monocytes and T-lymphocytes through its receptors, CXCR4 and CXCR7, and decreases monocyte adherence to surfaces coated with ICAM-1, a ligand for beta-2 integrins. SDF1A/CXCR4 signaling axis inhibits beta-2 integrin LFA-1 mediated adhesion of monocytes to ICAM-1 through LYN kinase. Inhibits CXCR4-mediated infection by T- cell line-adapted HIV-1. Plays a protective role after myocardial infarction. Induces down-regulation and internalization of CXCR7 expressed in various cells. Has several critical functions during embryonic development; required for B-cell lymphopoiesis, myelopoiesis in bone marrow and heart ventricular septum formation.

Related Products Docs