Select country change
Shopping cart (0 , 0,00 ) Menu Search
Manufactured by BioVendor

FAM19A5 Human E. coli

  • Regulatory status:RUO
  • Type:Recombinant protein
  • Source:E. coli
  • Other names:Chemokine-like protein TAFA-5, FAM19A5, TAFA5
  • Species:Human
Please select your region to see available products and prices.
Cat. No. Size Price


RD172478100 0.1 mg
PubMed Product Details
Technical Data

Type

Recombinant protein

Description

Total 110 AA. MW: 12.2 kDa (calculated). UniProtKB acc.no. Q7Z5A7–2 isoform 2 (Gln26-Ser125). N-terminal His-tag (10 extra AA). Protein identity confirmed by LC-MS/MS.

Amino Acid Sequence

MKHHHHHHASQFLKEGQLAAGTCEIVTLDRDSSQPRRTIARQTARCACRKGQIAGTTRARPACVDARIIKTKQWCDMLPCLEGEGCDLLINRSGWTCTQPGGRIKTTTVS

Source

E. coli

Purity

Purity as determined by densitometric image analysis: >95%

SDS-PAGE Gel

14 % SDS-PAGE separation of Human FAM19A5:
1. M.W. marker – 14, 21, 31, 45, 66, 97 kDa
2. Reduced and boiled sample, 2.5 μg/lane
3. Non-reduced and non-boiled sample, 2.5 μg/lane

Endotoxin

< 1.0 EU/μg

Formulation

0.2–0.9 mg/ml in 20 mM Tris buffer, 50 mM NaCl, pH 7.5, 10% (w/v) glycerol – filtered (0.4 μm), frozen

Reconstitution

Defrost at ambient temperature.Filter sterilize your culture media/working solutions containing this non-sterile product before using in cell culture.

Applications

Western blotting, ELISA

Shipping

On ice. Upon receipt, store the product at the temperature recommended below.

Storage/Expiration

Store protein at –80°C. Protein remains stable until the expiry date when stored at –80°C. Avoid repeated freezing/thawing cycles.

Quality Control Test

BCA to determine quantity of the protein.

SDS PAGE to determine purity of the protein.

LAL to determine quantity of endotoxin.

Note

This product is intended for research use only.

Related Products Documents