Select country set
language
Menu Shopping cart 0,00 Search
Manufactured by BioVendor

FAM3B Human, Rabbit Polyclonal Antibody

  • Regulatory status:RUO
  • Type:Polyclonal Antibody
  • Other names:PANDER, Cytokine-like protein 2-21, Pancreatic-derived factor, C21orf11, C21orf76, PRED44, UNQ320/PRO365
  • Species:Human
Please select your region to see available products and prices.
Cat. No. Size Price


RD181259100 0.1 mg
PubMed Product Details
Technical Data

Type

Polyclonal Antibody

Source of Antigen

E. coli

Hosts

Rabbit

Preparation

The antibody was raised in rabbits by immunization with the recombinant Human FAM3B.

Amino Acid Sequence

Total 216 AA. MW: 24,10 kDa (calculated). UniProtKB acc.no. P58499. N-Terminal His-tag (10 extra AA)

MKHHHHHHASELIPDAPLSSAAYSIRSIGERPVLKAPVPKRQKCDHWTPCPSDTYAYRLLSGGGRSKYAKICFEDNLLMGEQLGNVARGINIAIVNYVTGNVTATRCFDMYEGDNSGPMTKFIQSAAPKSLLFMVTYDDGSTRLNNDAKNAIEALGSKEIRNMKFRSSWVFIAAKGLELPSEIQREKINHSDAKNNRYSGWPAEIQIEGCIPKERS

Species Reactivity

Human. Not yet tested in other species.

Purification Method

Immunoaffinity chromatography on a column with immobilized recombinant Human FAM3B.

Antibody Content

0.1 mg (determined by BCA method, BSA was used as a standard)

Formulation

The antibody is lyophilized in 0.05 M phosphate buffer, 0.1 M NaCl, pH 7.2. AZIDE FREE.

Reconstitution

Add 0.2 ml of deionized water and let the lyophilized pellet dissolve completely. Slight turbidity may occur after reconstitution, which does not affect activity of the antibody. In this case clarify the solution by centrifugation.

Shipping

At ambient temperature. Upon receipt, store the product at the temperature recommended below.

Storage/Expiration

The lyophilized antibody remains stable and fully active until the expiry date when stored at -20°C. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles and store frozen at -80°C. Reconstituted antibody can be stored at 4°C for a limited period of time; it does not show decline in activity after one week at 4°C.

Quality Control Test

Indirect ELISA – to determine titer of the antibody SDS PAGE – to determine purity of the antibody BCA - to determine quantity of the antibody

Note

This product is for research use only.

Summary

Research topic

Diabetology - Other Relevant Products, Energy metabolism and body weight regulation

Related Products Docs