Select country set
language
Menu Shopping cart 0,00 Search
Manufactured by BioVendor

Granulocyte-Colony Stimulating Protein

  • Regulatory status:RUO
  • Type:Recombinant protein
  • Source:Chinese Hamster Ovary Cells (CHO)
  • Species:Human
Please select your region to see available products and prices.
Cat. No. Size Price


RP1763290002 0.002 mg
RP1763290010 0.01 mg
RP1763291000 1 mg
PubMed Product Details
Technical Data

Type

Recombinant protein

Description

Granulocyte Colony Stimulating Factor Human Recombinant produced in E.coli is a single, glycosylated, polypeptide chain containing 174 amino acids and having a molecular mass of 20 KD.G-CSF is purified by proprietary chromatographic techniques.

Amino Acid Sequence

TPLGPASSLPQSFLLKCLEQVRKIQGDGAALQEKLCATYKLCHPEELVLLGHSLGIPWAPLSSCPSQALQLAGCLSQLHSGLFLYQGLLQALEGISPELGPTLDTLQLDVADFATTIWQQMEELGMAPALQPTQGAMPAFASAFQRRAGGVLVASHLQSFLEVSYRVLRHLAQP

Source

Chinese Hamster Ovary Cells (CHO)

Purity

Greater than 97.0% as determined by: - Analysis by RP-HPLC. - Analysis by SDS-PAGE.

Biological Activity

The ED50, calculated by the dose-dependant proliferation of murine NFS-60 indicator cells (measured by 3H-thymidine uptake) is < 0.7 ng/ml, corresponding to a Specific Activity of 1.27×108 IU/mg.

Formulation

G-CSF was lyophilized from a concentrated (1mg/ml) solution containing Phosphate-Buffered Saline, pH 7.4

Shipping

At ambient temperature. Upon receipt, store the product at the temperature recommended below.

Storage/Expiration

Lyophilized Granulocyte Colony Stimulating Factor although stable at room temperature for 3 weeks, should be stored desiccated below –18°C. Upon reconstitution G-CSF should be stored a t 4°C between 2–7 days and for future use below –18°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Please prevent freeze-thaw cycles.

Physical Appearance

Sterile filtered white lyophilized (freeze-dried) powder.

Related Products Docs