United States set
language
Menu Shopping cart $0 Search
Manufactured by BioVendor

Omentin Human E. coli

  • Regulatory status:RUO
  • Type:Recombinant protein
  • Source:E. coli
  • Other names:Intelectin-1, ITLN-1, Intestinal lactoferrin receptor, Galactofuranose-binding lectin, Endothelial lectin HL-1, Omentin, INTL, ITLN, LFR, UNQ640/PRO1270
  • Species:Human
United States orders are shipped from our US branch, BioVendor, LLC
Cat. No. Size Price
1 - 4 pcs / 5 - 9 pcs / 10+ pcs


RD172100100 0.1 mg $421 / $370 / On request
PubMed Product Details
Technical Data

Type

Recombinant protein

Description

Total 294 AA. MW: 32.7 kDa (calculated). N-terminal His-tag, 14 extra AA. The AA sequence is identical to UniProtKB/Swiss-Prot entry Q8WWA0 (AA19–298).

Amino Acid Sequence

MRGSHHHHHHGMASTDEANTYFKEWTCSSSPSLPRSCKEIKDECPSAFDGLYFLRTENGVIYQTFCDMTSGGGGWTLVASVHENDMRGKCTVGDRWSSQQGSKAVYPEGDGNWANYNTFGSAEAATSDDYKNPGYYDIQAKDLGIWHVPNKSPMQHWRNSSLLRYRTDTGFLQTLGHNLFGIYQKYPVKYGEGKCWTDNGPVIPVVYDFGDAQKTASYYSPYGQREFTAGFVQFRVFNNERAANALCAGMRVTGCNTEHHCIGGGGYFPEASPQQCGDFSGFDWSGYGTHVGYS

Source

E. coli

Purity

˃ 90 % by SDS-PAGE

SDS-PAGE Gel

12% SDS-PAGE separation of Human Omentin
1. M.W. marker – 14, 21, 31, 45, 66, 97 kDa
2. reduced and heated sample, 5μg/lane
3. non-reduced and non-heated sample, 5μg/lane

Endotoxin

< 1.0 EU/µg

Formulation

Filtered (0.4 μm) and lyophilized in 0.5 mg/mL in 20 mM Tris, 50mM NaCl , pH 8.0

Reconstitution

Add deionized water to prepare a working stock solution of approximately 0.5 mg/mL and let the lyophilized pellet dissolve completely.

Applications

Western blotting

Shipping

At ambient temperature. Upon receipt, store the product at the temperature recommended below.

Storage/Expiration

Store the lyophilized protein at -80 °C. Lyophilized protein remains stable until the expiry date when stored at -80 °C. Aliquot reconstituted protein to avoid repeated freezing/thawing cycles and store at -80 °C for long term storage. Reconstituted protein can be stored at 4 °C for a week.

Quality Control Test

BCA to determine quantity of the protein.
SDS PAGE to determine purity of the protein. Endotoxin level determination.

Note

This product is intended for research use only.

Summary

Research topic

Diabetology - Other Relevant Products, Energy metabolism and body weight regulation, Reproduction

Summary

Omentin (intelectin-1, intestinal lactoferin receptor, endothelian lectin HL-1, galactofurano­sebinding lectin) is newly identified secretory protein that is highly and selectively expressed in visceral adipose tissue relative to subcutaneous adipose tissue (adipokine). The mature omentin is secretory glycoprotein consisting of 295 amino acids and 1-linked oligosacharides, and its basic structural unit is a 120-kDa homotrimer in which 40-kDa polipeptides are bridged by disulfide bonds. Omentin has been identified in other tissue at lower expression levels such are Paneth cells, endothelial cells, and visceral adipose stromal-vascular cells. A homolog of omentin has been identified that shares 83% amino acid identity with omentin and was referred to as omentin 2. The two omentin genes, omentin 1 and omentin 2, are localized adjacent to each other in chromosomal region, which has been previously linked to type 2 diabetes in several populations. To determine the impact of obesity-dependent insulin resistance on the regulation of two omentin isoforms, gene expression and plasma levels were measured in lean, overweight, and obese subjects. Omentin-1 was shown to be the major circulating isoform in human plasma. Lean subjects had significantly higher omentin-1 plasma levels than obese and overweight subjects. In addition, higher plasma omentin-1 levels were detected in women compared with men. Plasma omentin-1 levels were inversely correlated with BMI, waist circumference, leptin levels, and insulin resistance as measured by homeostasis model assessment and positively correlated with adiponectin and HDL levels. In summary, decreased omentin-1 levels are associated with increasing obesity and insulin resistance. An independent experiment reported that the addition of recombinant omentin-1 in vitro did not affect basal glucose uptake but did enhance insulin-stimulated glucose uptake in both subcutaneous and omental human adipocytes. Omentin-1 increased Akt phosphorylation in the absence and presence of insulin and may regulate insulin action. A recent study of women with the polycystic ovary syndrome (PCOS) found significantly reduced omentin-1 mRNA expression and protein levels in adipose tissue in overweight PCOS women. In addition, significantly lower plasma omentin-1 levels were detected in these women.

Product References (5)

References

  • Binti Kamaruddin NA, Fong LY, Tan JJ, Abdullah MNH, Singh Cheema M, Bin Yakop F, Yong YK. Cytoprotective Role of Omentin Against Oxidative Stress-Induced Vascular Endothelial Cells Injury. Molecules. 2020 May 29;25(11):2534. doi: 10.3390/molecules25112534. PubMed PMID: 32485974. PubMed CentralPMCID: PMC7321413. See more on PubMed
  • Kazama K, Okada M, Yamawaki H. A novel adipocytokine, omentin, inhibits monocrotaline-induced pulmonary arterial hypertension in rats. Biochem Biophys Res Commun. 2014 Sep 12;452(1):142-6. doi: 10.1016/j.bbrc.2014.08.070. Epub 2014 Aug 21. PubMed PMID: 25152392. See more on PubMed
  • Kazama K, Usui T, Okada M, Hara Y, Yamawaki H. Omentin plays an anti-inflammatory role through inhibition of TNF-α-induced superoxide production in vascular smooth muscle cells. Eur J Pharmacol. 2012 Jul 5;686(1-3):116-23. doi: 10.1016/j.ejphar.2012.04.033. Epub 2012 Apr 24. PubMed PMID: 22554771. See more on PubMed
  • Yamawaki H, Tsubaki N, Mukohda M, Okada M, Hara Y. Omentin, a novel adipokine, induces vasodilation in rat isolated blood vessels. Biochem Biophys Res Commun. 2010 Mar 19;393(4):668-72. doi: 10.1016/j.bbrc.2010.02.053. Epub 2010 Feb 17. PubMed PMID: 20170632. See more on PubMed
  • Sakuragawa N. [Clinical significance of thrombomodulin analysis in blood coagulo-fibrinolytic tests]. Nihon Rinsho. 1989 Dec;48 Suppl:881-4. PubMed PMID: 2560081. See more on PubMed
Summary References (10)

References to Omentin-1

  • de Souza Batista CM, Yang RZ, Lee MJ, Glynn NM, Yu DZ, Pray J, Ndubuizu K, Patil S, Schwartz A, Kligman M, Fried SK, Gong DW, Shuldiner AR, Pollin TI, McLenithan JC. Omentin plasma levels and gene expression are decreased in obesity. Diabetes. 2007 Jun;56 (6):1655-61
  • Moreno-Navarrete JM, Catalan V, Ortega F, Gomez-Ambrosi J, Ricart W, Fruhbeck G, Fernandez-Real JM. Circulating omentin concentration increases after weight loss. Nutr Metab (Lond). 2010;7:27
  • Pan HY, Guo L, Li Q. Changes of serum omentin-1 levels in normal subjects and in patients with impaired glucose regulation and with newly diagnosed and untreated type 2 diabetes. Diabetes Res Clin Pract. 2010 Apr;88 (1):29-33
  • Schaffler A, Neumeier M, Herfarth H, Furst A, Scholmerich J, Buchler C. Genomic structure of human omentin, a new adipocytokine expressed in omental adipose tissue. Biochim Biophys Acta. 2005 Dec 30;1732 (1-3):96-102
  • Tan BK, Adya R, Farhatullah S, Lewandowski KC, O'Hare P, Lehnert H, Randeva HS. Omentin-1, a novel adipokine, is decreased in overweight insulin-resistant women with polycystic ovary syndrome: ex vivo and in vivo regulation of omentin-1 by insulin and glucose. Diabetes. 2008 Apr;57 (4):801-8
  • Tan BK, Adya R, Farhatullah S, Lewandowski KC, O'Hare P, Lehnert H, Randeva HS. Omentin-1, a novel adipokine, is decreased in overweight insulin-resistant women with polycystic ovary syndrome: ex vivo and in vivo regulation of omentin-1 by insulin and glucose. Diabetes. 2008 Apr;57 (4):801-8
  • Wurm S, Neumeier M, Weigert J, Schaffler A, Buechler C. Plasma levels of leptin, omentin, collagenous repeat-containing sequence of 26-kDa protein (CORS-26) and adiponectin before and after oral glucose uptake in slim adults. Cardiovasc Diabetol. 2007;6:7
  • Yamawaki H, Tsubaki N, Mukohda M, Okada M, Hara Y. Omentin, a novel adipokine, induces vasodilation in rat isolated blood vessels. Biochem Biophys Res Commun. 2010 Mar 19;393 (4):668-72
  • Yang RZ, Lee MJ, Hu H, Pray J, Wu HB, Hansen BC, Shuldiner AR, Fried SK, McLenithan JC, Gong DW. Identification of omentin as a novel depot-specific adipokine in human adipose tissue: possible role in modulating insulin action. Am J Physiol Endocrinol Metab. 2006 Jun;290 (6):E1253-61
  • Yilmaz Y, Yonal O, Kurt R, Alahdab YO, Eren F, Ozdogan O, Celikel CA, Imeryuz N, Kalayci C, Avsar E. Serum levels of omentin, chemerin and adipsin in patients with biopsy-proven nonalcoholic fatty liver disease. Scand J Gastroenterol. 2011 Jan;46 (1):91-7
Related Products Docs
Subscribe to Our Newsletter! Discover News from
BioVendor R&D
Subscribe Now
Subscribe to Our Newsletter! Discover News from
BioVendor R&D
Subscribe Now
zavřít