Type
Polyclonal Antibody
Applications
Western blotting, ELISA
Source of Antigen
E. coli
Hosts
Sheep
Preparation
The antibody was raised in sheep by immunization with the recombinant Human AIF-1.
Amino Acid Sequence
The immunization antigen (17,7 kDa) is a protein containing 155 AA of recombinant Human AIF-1. N-Terminal His-tag, 9 extra AA (highlighted).
MKHHHHHHASQTRDLQGGKAFGLLKAQQEERLDEINKQFLDDPKYSSDEDLPSKLEGFKEKYMEFDLNGNGDIDIMSLKRMLEKLGVPKTHLELKKLIGEVSSGSGETFSYPDFLRMMLGKRSAILKMILMYEEKAREKEKPTGPPAKKAISELP
Species Reactivity
Human. Not yet tested in other species.
Purification Method
Immunoaffinity chromatography on a column with immobilized recombinant Human AIF-1.
Antibody Content
0.1 mg (determined by BCA method, BSA was used as a standard)
Formulation
The antibody is lyophilized in 0.05 M phosphate buffer, 0.1 M NaCl, pH 7.2. AZIDE FREE.
Reconstitution
Add 0.2 ml of deionized water and let the lyophilized pellet dissolve completely. Slight turbidity may occur after reconstitution, which does not affect activity of the antibody. In this case clarify the solution by centrifugation.
Shipping
At ambient temperature. Upon receipt, store the product at the temperature recommended below.
Storage/Expiration
The lyophilized antibody remains stable and fully active until the expiry date when stored at –20°C. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles and store frozen at –80°C. Reconstituted antibody can be stored at 4°C for a limited period of time; it does not show decline in activity after one week at 4°C.
Quality Control Test
Indirect ELISA – to determine titer of the antibody
SDS PAGE – to determine purity of the antibody
Note
This product is for research use only.
Research topic
Cardiovascular disease, Immune Response, Infection and Inflammation, Transplantation
Summary
Allograft inflammatory factor 1 (AIF-1), is a 17kDa cytoplasm, calcium-binding protein that in humans is encoded by the AIF1 gene. This gene is induced by cytokines and interferon. Three transcript variants encoding different isoforms have been found for this gene. The AIF1 gene is conserved in chimpanzee, Rhesus monkey, dog, cow, mouse, and rat. Allograft inflammatory factor 1 plays a important role in vascular inflammation. AIF-1 is thought to be involved in negative regulation of growth of vascular smooth muscle cells, which contributes to the anti-inflammatory response to vessel wall trauma. AIF-1 also plays an important role in immune response and vasculopathy in allografts. AIF-1 was found in both cardiac allografts and hearts with other cardiac cellular diseases. In cardiac allografts, expression levels of AIF-1 in both cardiomyocytes and mononuclear cells directly correlated with the severity of cardiac cellular rejection. Thus, AIF-1 shows promise that it can be a potential biomarker for cardiac allograft rejection. AIF-1 is a protein whose expression in transplanted human hearts correlates with rejection and development of coronary artery vasculopathy (CAV). AIF-1 is crucial for the survival and pro-inflammatory activity of macrophages. Pro-inflammatory cytokines induced p-regulation of AIF-1 in macrophages. AIF-1 promote the activation and proliferation of T-lymphocytes and enhances lymphocyte migration. In human coronary artery vasculopathy, AIF-1 is expressed in T lymphocytes, and expression increases when T cells are activated. Increased numbers of AIF-1 immunoreactive macrophages/microglial cells were observed in focal human brain infarctions and human traumatic brain injury, in inflammatory lesions of a rat model of autoimmune disease and other disorders. Functional studies revealed that AIF-1 is secreted into the blood stream during experimental autoimmune neuritis. The results of several studies suggest that enhanced AIF-1 expression leads to augmented incorporation of degenerated LDL by macrophages and promotes development of atherosclerotic vasculopathy. AIF-1 is also expressed in tissues from patients with systemic sclerosis.