Select country set
language
Menu Shopping cart 0,00 Search
Manufactured by BioVendor

Intestinal Fatty Acid Binding Protein Human E. coli

  • Regulatory status:RUO
  • Type:Recombinant protein
  • Source:E. coli
  • Other names:Fatty acid-binding protein 2, Intestinal-type fatty acid-binding protein, I-FABP, FABP2, FABPI
  • Species:Human
Please select your region to see available products and prices.
Cat. No. Size Price


RD172246100 0.1 mg
PubMed Product Details
Technical Data

Type

Recombinant protein

Description

Total 141 AA. MW: 16.32 kDa (calculated). UniProtKB acc.no. P12104. N-Terminal His-tag (10 extra AA)

Amino Acid Sequence

MKHHHHHHASAFDSTWKVDRSENYDKFMEKMGVNIVKRKLAAHDNLKLTITQEGNKFTVKESSAFRNIEVVFELGVTFNYNLADGTELRGTWSLEGNKLIGKFKRTDNGNELNTVREIIGDELVQTYVYEGVEAKRIFKKD

Source

E. coli

Purity

>95%

SDS-PAGE Gel

14% SDS-PAGE separation of Human FABP-2
1. M.W. marker – 97, 66, 45, 31, 21, 14 kDa
2. reduced and boiled sample, 5μg/lane
3. non-reduced and non-boiled sample, 5μg/lane

Endotoxin

< 0.1 EU/μg

Formulation

Filtered (0.4 μm) and lyophilized from 0.5 mg/ml solution in phosphate buffered saline, pH 7.4

Reconstitution

Add deionized water to prepare a working stock solution of approximately 0.5 mg/mL and let the lyophilized pellet dissolve completely. Filter sterilize your culture media/working solutions containing this non-sterile product before using in cell culture.

Applications

Western blotting, ELISA

Shipping

At ambient temperature. Upon receipt, store the product at the temperature recommended below.

Storage/Expiration

Store lyophilized protein at –80°C. Lyophilized protein remains stable until the expiry date when stored at –80°C. Aliquot reconstituted protein to avoid repeated freezing/thawing cycles and store at –80°C for long term storage. Reconstituted protein can be stored at 4°C for a week.

Quality Control Test

BCA to determine quantity of the protein.

SDS PAGE to determine purity of the protein.

LAL to determine quantity of endotoxin.

Note

This product is intended for research use only.

Summary

Research topic

Others

Summary References (11)

References to Intestinal Fatty Acid Binding Protein

  • Pelsers MMAL, Namiot Z, Kisielewski W, Namiot A, Januszkiewicz M, Hermens WT, Glatz JFC: Intestinal-type and liver-type fatty acid-binding protein in the intestine. Tissue distribution and clinical utility. Clin Biochem 2003, 36:529-535
  • Storch J, McDermott L: Structural and functional analysis of fatty acid-binding proteins. J Lipid Res 2009, S126-S131
  • Turkovic LF, Pizent A, Dodig S, Pavlovic M, Pasalic D: FABP 2 gene polymorphism and metabolic syndrome in elderly people of Croatian descent. Bioch Medica 2012, 22(2):217-224
  • Sakamoto K, Kanda T, Bamba T, Funaoka H, Kosugi S, Yajima K, Ishikawa T: Serum intestinal fatty acid binding protein in patients with small bowel obstruction. Surg Science 2013, 4:302-307
  • Ishimura S, Furuhashi M, Watanabe Y, Hoshina K, Fuseya T, Mita T, Okazaki Y, Koyama M, Tanaka M, Akasaka H, Ohnishi H, Yoshida H, Saitoh S, Miura T: Circulating levels of fatty acid-binding protein family and metabolic phenotype in the general population. PlosOne 2013, 8(11):e81318
  • Van der Voort PHJ, Westra B, Wester JPJ, Bosman RJ, van Stijn I, Haagen IA, Loupatty FJ, Rijkenberg S: Can serum L-lactate, D-lactate, creatine kinase and I-FABP be used as diagnostic markers in critically ill patients suspected for bowel ischemia. BMC Anestesiology 2014, 14:111
  • Schurink M, Kooi EMW, Hulzebos ChV, Kox RG, Groen H, Heineman E, Bos AF, Hulscher: Intestinal fatty acid-binding protein as a diagnostic marker for complicated and uncomplicated necrotizing enterocolitis: a prospective cohort study. Plos One 2015,
  • Elnady HG, Sherif LS, Saleh MT, El-Alameey IR, Youssef MM, Shafie AIE, Helwa I, Raouf HA, EL-Taweel AN: Prediction of gut wall integrity loss in viral gastroenteritis by noninvasive marker. OA Maced J Med Sci 2015, 3(1):37-45
  • Heida FH, Hulscher JBF, Schurink M, Timmer A, Kooi EMW, Bos AF, Bruggink JLM, Kasper DC, Pones M, Benkoe T: Intestinal fatty acid-binding protein levels in necrotizing enterocolitis correlate with extent of necrotic bowel: results from multicenter study. J Pediatr Surg 2015, 50(7):1115-1118+
  • Sun DL, Cen YY, Li SM, Li WM, Lu QP, Xu PY: Accuracy of the serum intestinal fatty-acidbinding protein for diagnosis of acute intestinal ischemia: a meta-analysis. Scientific Reports 2016, 6:34371
  • Coufal S, Kokesova A, Tlaskalova-Hogenova H, Snajdauf J, Rygl M, Kverka M: Urinary intestinal fatty acid-binding protein can distinguish necrotizing enterocolitis from sepsis in early stage of the disease. J Immunol Res 2016:5727312.
Related Products Docs