United States set
language
Menu Shopping cart $0 Search
Manufactured by BioVendor

Liver Fatty Acid Binding Protein Human, Sheep Polyclonal Antibody

  • Regulatory status:RUO
  • Type:Polyclonal Antibody
  • Other names:L-FABP, Fatty acid-binding protein 1, FABP1, FABPL
  • Species:Human
United States orders are shipped from our US branch, BioVendor, LLC
Cat. No. Size Price
1 pc / 2 - 5 pcs / 6+ pcs


RD184240100 0.1 mg $277 / $243 / On request
PubMed Product Details
Technical Data

Type

Polyclonal Antibody

Applications

Western blotting

Source of Antigen

E. coli

Hosts

Sheep

Isotype

IgG

Preparation

The antibody was raised in sheep by immunization with the recombinant Human L-FABP.

Amino Acid Sequence

Recombinant Human L-FABP, total 137 AA. MW: 15.45 kDa (calculated). UniProtKB acc.no. P07148. N-Terminal His-tag, 10 extra AA.

MKHHHHHHASMSFSGKYQLQSQENFEAFMKAIGLPEELIQKGKDIKGVSEIVQNGKHFKFTITAGSKVIQNEFTVGEECELETMTGEKVKTVVQLEGDNKLVTTFKNIKSVTELNGDIITNTMTLGDIVFKRISKRI

Species Reactivity

Human. Not yet tested in other species.

Purification Method

Immunoaffinity chromatography on a column with immobilized recombinant Human  L-FABP, Tag-free (RD172240101).

Antibody Content

0.1 mg (determined by BCA method, BSA was used as a standard)

Formulation

The antibody is lyophilized in 0.05 M phosphate buffer, 0.1 M NaCl, pH 7.2. 

Reconstitution

Add 0.2 ml of deionized water and let the lyophilized pellet dissolve completely. Slight turbidity may occur after reconstitution, which does not affect activity of the antibody. In this case clarify the solution by centrifugation.

Shipping

At ambient temperature. Upon receipt, store the product at the temperature recommended below.

Storage/Expiration

The lyophilized antibody remains stable and fully active until the expiry date when stored at -20°C. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles and store frozen at -80°C. Reconstituted antibody can be stored at 4°C for a limited period of time; it does not show decline in activity after one week at 4°C.

Quality Control Test

Indirect ELISA – to determine titer of the antibody SDS PAGE – to determine purity of the antibody BCA - to determine quantity of the antibody

Note

This product is for research use only.

Summary

Research topic

Renal disease

Related Products Docs
Subscribe to Our Newsletter! Discover News from
BioVendor R&D
Subscribe Now
Subscribe to Our Newsletter! Discover News from
BioVendor R&D
Subscribe Now
zavřít