Select country change
Shopping cart (0 , 0,00 ) Menu Search
Manufactured by BioVendor

Neudesin Human, Rabbit Polyclonal Antibody

  • Regulatory status:RUO
  • Type:Polyclonal Antibody
  • Other names:Cell immortalization-related protein 2, Neuron-derived neurotrophic factor, Secreted protein of unknown function, SPUF protein, NENF, CIR2, SPUF
  • Species:Human
Please select your region to see available products and prices.
Cat. No. Size Price


New RD181276100 0.1 mg
PubMed Product Details
Technical Data

Type

Polyclonal Antibody

Applications

ELISA

Source of Antigen

E. coli

Hosts

Rabbit

Isotype

IgG

Preparation

The antibody was raised in rabbits by immunization with the recombinant Human Neudesin.

Amino Acid Sequence

Recombinant Human Neudesin, total 151 AA. MW 16.9 kDa (calculated). UniProtKB acc. No. Q9UMX5 (Gly32-Phe172). N-terminal His-tag, 10 extra AA (highlighted).

MKHHHHHHASGQTPRPAERGPPVRLFTEEELARYGGEEEDQPIYLAVKGVVFDVTSGKEFYGRGAPYNALTGKDSTRGVAKMSLDPADLTHDTTGLTAKELEALDEVFTKVYKAKYPIVGYTARRILNEDGSPNLDFKPEDQPHFDIKDEF

Species Reactivity

Human. Not yet tested in other species.

Purification Method

Immunoaffinity chromatography on a column with immobilized recombinant Human Neudesin.

Antibody Content

0.1 mg (determined by BCA method, BSA was used as a standard)

Formulation

The antibody is lyophilized in 0.05 M phosphate buffer, 0.1 M NaCl, pH 7.2. AZIDE FREE.

Reconstitution

Add 0.2 ml of deionized water and let the lyophilized pellet dissolve completely. Slight turbidity may occur after reconstitution, which does not affect activity of the antibody. In this case clarify the solution by centrifugation.

Shipping

At ambient temperature. Upon receipt, store the product at the temperature recommended below.

Storage/Expiration

The lyophilized antibody remains stable and fully active until the expiry date when stored at –20°C. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles and store frozen at –80°C. Reconstituted antibody can be stored at 4°C for a limited period of time; it does not show decline in activity after one week at 4°C.

Quality Control Test

Indirect ELISA – to determine titer of the antibody SDS PAGE – to determine purity of the antibody

Note

This product is for research use only.

Summary

Research topic

Energy metabolism and body weight regulation, Neural tissue markers, Oncology

Summary

Human neudesin (alternative names: Cell immortalization-related protein 2, CIR2; Neuron-derived neurotrophic factor, NENF; Secreted protein of unknown function, SPUF; candidate oncogene GIG47) protein comprises 172 amino acid residues including 31 residues of the hypothesised signal sequence. The human neudesin gene was mapped to chromosome 1p33. Neudesin belongs to the MAPR (membrane-associated progesterone receptor) family which includes PGRMC1, PGRMC2, neudesin, and neuferricin, and is a subfamily of the Cyt-b5 family, which consists of heme-binding proteins with a Cyt-b5-like heme/steroid-binding domain in their central regions. Neudesin neurotrophic activity is dependent on the binding of heme to its cytochrome b5-like heme/steroid-binding domain. Mouse neudesin mRNA is expressed abundantly in the developing brain and spinal cord in embryos, but is expressed widely in postnatal tissues including brain, heart, lung, and kidney. In the brain the mRNA was expressed in neurons but not glial cells. The protein exhibited significant neurotrophic activity in primary cultured mouse neurons but no mitogenic activity was observed in primary cultured mouse astrocytes. Neudesin activated the mitogen-activated protein (MAP) and phosphatidyli­nositol-3 (PI-3) kinase pathways. It has been found that neudesin is expressed in the mouse embryonic cerebral cortex and the neural precursor cells where it significantly promotes neuronal differentiation but inhibits astrocyte differentiation. In addition, it transiently promotes neural cell proliferation in the neural precursor cells during the early stages of development. Over-expression of neudesin has been observed in primary breast tumors as well as other human tumors including carcinomas of the uterine cervix, malignant lymphoma, colon, lung, skin, and leukemia. The ectopic expression of neudesin (GIG47 oncogene) in MCF7 cells promoted invasiveness in the presence of 50% serum and also increased tumorigenicity in in vivo tumor formation assay. The tumorigenesis mechanism involving neudesin might be mediated by the activation of MAPK and PI3K pathways. Neudesin may play a role in the breast tumorigenesis, thus representing a novel target for the treatment of breast cancer. Abundant expression of neudesin in white adipose tissue of adult mice has been reported. Neudesin-hemin significantly suppressed adipogenesis in 3T3-L1 cells. On the other hand, the knockdown of neudesin by RNA interference markedly promoted adipogenesis in 3T3-L1 cells and decreased MAPK activation during adipocyte differentiation. These findings suggest that neudesin plays a critical role in the early stage of adipocyte differentiation. Robust neudesin expression has been observed in hypothalamic nuclei known to regulate food intake, and its expression was altered under the diet-induced obese (DIO) condition relative to the fed state. Hypothalamic neudesin mRNA was regulated by brain-derived neurotrophic factor (BDNF) signaling, itself an important regulator of appetite. Delivery of purified recombinant BDNF into the lateral cerebral ventricle of mice decreased hypothalamic neudesin expression, while pharmacological inhibition of trkB signaling increased neudesin (NENF) mRNA expression. Furthermore, recombinant NENF administered via an intracerebroven­tricular cannula decreased food intake and body weight and increased hypothalamic Pomc and Mc4r mRNA expression. The appetite-suppressing effect of NENF was abrogated in obese mice fed a high-fat diet, demonstrating a diet-dependent modulation of NENF function. The existence of a hypothetical regulatory circuit involving BDNF, NENF, and melanocortin signaling has been proposed.

Summary References (14)

References to Neudesin

  • Byerly MS, Swanson RD, Semsarzadeh NN, McCulloh PS, Kwon K, Aja S, Moran TH, Wong GW, Blackshaw S. Identification of hypothalamic neuron-derived neurotrophic factor as a novel factor modulating appetite. Am J Physiol Regul Integr Comp. 2013 Jun 15;304 (12):R1085-95
  • Han KH, Lee SH, Ha SA, Kim HK, Lee C, Kim DH, Gong KH, Yoo J, Kim S, Kim JW. The functional and structural characterization of a novel oncogene GIG47 involved in the breast tumorigenesis. BMC Cancer. 2012;12:274
  • Kimura I, Konishi M, Asaki T, Furukawa N, Ukai K, Mori M, Hirasawa A, Tsujimoto G, Ohta M, Itoh N, Fujimoto M. Neudesin, an extracellular heme-binding protein, suppresses adipogenesis in 3T3-L1 cells via the MAPK cascade. Biochem Biophys Res Commun. 2009 Mar 27;381 (1):75-80
  • Kimura I, Konishi M, Miyake A, Fujimoto M, Itoh N. Neudesin, a secreted factor, promotes neural cell proliferation and neuronal differentiation in mouse neural precursor cells. J Neurosci Res. 2006 Jun;83 (8):1415-24
  • Kimura I, Nakayama Y, Yamauchi H, Konishi M, Miyake A, Mori M, Ohta M, Itoh N, Fujimoto M. Neurotrophic activity of neudesin, a novel extracellular heme-binding protein, is dependent on the binding of heme to its cytochrome b5-like heme/steroid-binding domain. J Biol Chem. 2008 Feb 15;283 (7):4323-31
  • Kimura I, Nakayama Y, Zhao Y, Konishi M, Itoh N. Neurotrophic effects of neudesin in the central nervous system. Front Neurosci. 2013;7:111
  • Kimura I, Yoshioka M, Konishi M, Miyake A, Itoh N. Neudesin, a novel secreted protein with a unique primary structure and neurotrophic activity. J Neurosci Res. 2005 Feb 1;79 (3):287-94
  • Byerly MS, Swanson RD, Semsarzadeh NN, McCulloh PS, Kwon K, Aja S, Moran TH, Wong GW, Blackshaw S. Identification of hypothalamic neuron-derived neurotrophic factor as a novel factor modulating appetite. Am J Physiol Regul Integr Comp. 2013 Jun 15;304 (12):R1085-95
  • Han KH, Lee SH, Ha SA, Kim HK, Lee C, Kim DH, Gong KH, Yoo J, Kim S, Kim JW. The functional and structural characterization of a novel oncogene GIG47 involved in the breast tumorigenesis. BMC Cancer. 2012;12:274
  • Kimura I, Konishi M, Asaki T, Furukawa N, Ukai K, Mori M, Hirasawa A, Tsujimoto G, Ohta M, Itoh N, Fujimoto M. Neudesin, an extracellular heme-binding protein, suppresses adipogenesis in 3T3-L1 cells via the MAPK cascade. Biochem Biophys Res Commun. 2009 Mar 27;381 (1):75-80
  • Kimura I, Konishi M, Miyake A, Fujimoto M, Itoh N. Neudesin, a secreted factor, promotes neural cell proliferation and neuronal differentiation in mouse neural precursor cells. J Neurosci Res. 2006 Jun;83 (8):1415-24
  • Kimura I, Nakayama Y, Yamauchi H, Konishi M, Miyake A, Mori M, Ohta M, Itoh N, Fujimoto M. Neurotrophic activity of neudesin, a novel extracellular heme-binding protein, is dependent on the binding of heme to its cytochrome b5-like heme/steroid-binding domain. J Biol Chem. 2008 Feb 15;283 (7):4323-31
  • Kimura I, Nakayama Y, Zhao Y, Konishi M, Itoh N. Neurotrophic effects of neudesin in the central nervous system. Front Neurosci. 2013;7:111
  • Kimura I, Yoshioka M, Konishi M, Miyake A, Itoh N. Neudesin, a novel secreted protein with a unique primary structure and neurotrophic activity. J Neurosci Res. 2005 Feb 1;79 (3):287-94
Related Products Docs