Select country change
Shopping cart (0 , 0,00 ) Menu Search
Manufactured by BioVendor

Neuroglobin Human, Mouse Monoclonal Antibody, Clone: 13C8

  • Regulatory status:RUO
  • Type:Monoclonal Antibody
  • Other names:NGB
  • Species:Human
Please select your region to see available products and prices.
Cat. No. Size Price


RD182043100-C8 0.1 mg
PubMed Product Details
Technical Data

Type

Monoclonal Antibody

Applications

Immunohistochemistry

Antibodies Applications

Source of Antigen

E. coli

Hosts

Mouse

Isotype

IgG1

Clone

13C8

Preparation

The antibody is a mouse monoclonal antibody against recombinant Human Neuroglobin.

Amino Acid Sequence

The immunization antigen (17 kDa) is a protein containing 150 AA of recombinant Human Neuroglobin and one extra AA, N-terminal methionin (highlighted).

MERPEPELIRQSWRAVSRSPLEHGTVLFARLFALEPDLLPLFQYNCRQFSSPEDCLSSPEFLDHIRKVMLVIDAAVTNVEDLSSLEEYLASLGRKHRAVGVKLSSFSTVGESLLYMLEKCLGPAFTPATRAAWSQLYGAVVQAMSRGWDGE

The amino acid sequence of the recombinant Human Neuroglobin is 100% homologous with the amino acid sequence of the Human Neuroglobin

Species Reactivity

Human. Not yet tested in other species.

Purification Method

Affinity chromatography on a column with immobilized protein G.

Antibody Content

0.1 mg (determined by BCA method, BSA was used as a standard)

Formulation

The antibody is lyophilized in 0.05 M phosphate buffer, 0.1 M NaCl, pH 7.2. AZIDE FREE.

Reconstitution

Add 0.1 ml of deionized water and let the lyophilized pellet dissolve completely. Slight turbidity may occur after reconstitution, which does not affect activity of the antibody. In this case clarify the solution by centrifugation.

Shipping

At ambient temperature. Upon receipt, store the product at the temperature recommended below.

Storage/Expiration

The lyophilized antibody remains stable and fully active until the expiry date when stored at –20°C. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles and store frozen at –80°C. Reconstituted antibody can be stored at 4°C for a limited period of time; it does not show decline in activity after one week at 4°C.

Quality Control Test

Indirect ELISA – to determine titer of the antibody SDS PAGE – to determine purity of the antibody

Note

This product is for research use only.

Summary

Research topic

Neural tissue markers

Summary

Neuroglobin, 151 amino acid reside protein, mainly expressed in vertebrate brain and retina, is a recently identified member of the globin superfamily. Augmenting O(2) supply, neuroglobin promotes survival of neurons upon hypoxic injury, potentially limiting brain damage. Moreover, neuroglobin may be a novel oxidative stress-responsive sensor for signal transduction in the brain. Neuroglobin expression is increased by neuronal hypoxia in vitro and focal cerebral ischemia in vivo, and neuronal survival after hypoxia is reduced by inhibiting neuroglobin expression with an antisense oligodeoxynucle­otide and enhanced by neuroglobin overexpression

Product References (5)

References

  • Ostojic J, Grozdanic S, Syed NA, Hargrove MS, Trent JT 3rd, Kuehn MH, KardonRH, Kwon YH, Sakaguchi DS. Neuroglobin and cytoglobin distribution in theanterior eye segment: a comparative immunohistochemical study. J HistochemCytochem. 2008 Sep;56(9):863-72. doi: 10.1369/jhc.2008.951392. Epub 2008 Jun 23. PubMed PMID: 18574250; PubMed Central PMCID: PMC2516955. See more on PubMed
  • Ostojić J, Grozdanić SD, Syed NA, Hargrove MS, Trent JT 3rd, Kuehn MH, KwonYH, Kardon RH, Sakaguchi DS. Patterns of distribution of oxygen-binding globins, neuroglobin and cytoglobin in human retina. Arch Ophthalmol. 2008Nov;126(11):1530-6. doi: 10.1001/archopht.126.11.1530. PubMed PMID: 19001220. See more on PubMed
  • Ostojić J, Sakaguchi DS, de Lathouder Y, Hargrove MS, Trent JT 3rd, Kwon YH,Kardon RH, Kuehn MH, Betts DM, Grozdanić S. Neuroglobin and cytoglobin:oxygen-binding proteins in retinal neurons. Invest Ophthalmol Vis Sci. 2006Mar;47(3):1016-23. PubMed PMID: 16505036. See more on PubMed
  • Xun Y, Li Z, Tang Y, Yang M, Long S, Shu P, Li J, Xiao Y, Tang F, Wei C, LiuN, Xiang S. Neuroglobin Regulates Wnt/β-Catenin and NFκB Signaling Pathwaythrough Dvl1. Int J Mol Sci. 2018 Jul 23;19(7). pii: E2133. doi:10.3390/ijms19072133. PubMed PMID: 30041403; PubMed Central PMCID: PMC6073292. See more on PubMed
  • Emara M, Salloum N, Allalunis-Turner J. Expression and hypoxic up-regulationof neuroglobin in human glioblastoma cells. Mol Oncol. 2009 Feb;3(1):45-53. doi: 10.1016/j.molonc.2008.11.002. Epub 2008 Dec 12. PubMed PMID: 19383366; PubMedCentral PMCID: PMC5527870. See more on PubMed
Summary References (5)

References to Neuroglobin

  • Garry DJ, Mammen PP. Neuroprotection and the role of neuroglobin. Lancet. 2003 Aug 2;362 (9381):342-3
  • Mammen PP, Shelton JM, Goetsch SC, Williams SC, Richardson JA, Garry MG, Garry DJ. Neuroglobin, a novel member of the globin family, is expressed in focal regions of the brain. J Histochem Cytochem. 2002 Dec;50 (12):1591-8
  • Pesce A, Dewilde S, Nardini M, Moens L, Ascenzi P, Hankeln T, Burmester T, Bolognesi M. Human brain neuroglobin structure reveals a distinct mode of controlling oxygen affinity. Structure. 2003 Sep;11 (9):1087-95
  • Sun Y, Jin K, Mao XO, Zhu Y, Greenberg DA. Neuroglobin is up-regulated by and protects neurons from hypoxic-ischemic injury. Proc Natl Acad Sci U S A. 2001 Dec 18;98 (26):15306-11
  • Sun Y, Jin K, Peel A, Mao XO, Xie L, Greenberg DA. Neuroglobin protects the brain from experimental stroke in vivo. Proc Natl Acad Sci U S A. 2003 Mar 18;100 (6):3497-500
Related Products Docs