United States set
language
Menu Shopping cart $0 Search
Manufactured by BioVendor

Osteoblast Specific Factor 1 Human, Rabbit Polyclonal Antibody

  • Regulatory status:RUO
  • Type:Polyclonal Antibody
  • Other names:Pleiotrophin, PTN, Heparin-binding growth-associated molecule, HB-GAM, Heparin-binding growth factor 8, HBGF-8, OSF-1, Heparin-binding neurite outgrowth-promoting factor 1, HBNF-1, Heparin-binding brain mitogen, HBBM
  • Species:Human
United States orders are shipped from our US branch, BioVendor, LLC
Cat. No. Size Price
1 pc / 2 - 5 pcs / 6+ pcs


RD181044050 0.05 mg $300 / $266 / On request
PubMed Product Details
Technical Data

Type

Polyclonal Antibody

Applications

Western blotting

Source of Antigen

E. coli

Hosts

Rabbit

Preparation

The antibody was raised in rabbits by immunization with the recombinant Human OSF-1.

Amino Acid Sequence

The immunization antigen (17.3 kDa) is a protein containing 152 AA of recombinant Human OSF-1. N-Terminal His-tag and thrombin cleavage site 16 AA.

MKHHHHHHHMLVPRGSGKKEKPEKKVKKSDCGEWQWSVCVPTSGDCGLGTREGTRTGAECKQTMKTQRCKIPCNWKKQFGAECKYQFQAWGECDLNTALKTRTGSLKRALHNAECQKTVTISKPCGKLTKPKPQAESKKKKKEGKKQEKMLD

Species Reactivity

Human. Not yet tested in other species.

Purification Method

Immunoaffinity chromatography on a column with immobilized recombinant Human OSF-1.

Antibody Content

0.05 mg (determined by BCA method, BSA was used as a standard)

Formulation

The antibody is lyophilized in 0.05 M phosphate buffer, 0.1 M NaCl, pH 7.2. 

Reconstitution

Add 0.1 ml of deionized water and let the lyophilized pellet dissolve completely. Slight turbidity may occur after reconstitution, which does not affect activity of the antibody. In this case clarify the solution by centrifugation.

Shipping

At ambient temperature. Upon receipt, store the product at the temperature recommended below.

Storage/Expiration

The lyophilized antibody remains stable and fully active until the expiry date when stored at -20°C. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles and store frozen at -80°C. Reconstituted antibody can be stored at 4°C for a limited period of time; it does not show decline in activity after one week at 4°C.

Quality Control Test

Indirect ELISA – to determine titer of the antibody SDS PAGE – to determine purity of the antibody BCA - to determine quantity of the antibody

Note

This product is for research use only.

Summary

Research topic

Bone and cartilage metabolism, Cytokines and chemokines and related molecules, Extracellular matrix

Summary

Pleiotrophin (Osteoblast-Specific Factor-1, OSF-1) contains 136 amino acid residues. The sequence is very rich in cationic amino acids (24% of the residues); lysine cluster sequences are found in the N-terminal and C-terminal ends of the structure. The OSF-1 gene was shown by Northern blotting analysis to be expressed in mouse calvarial osteoblast-enriched cells and in mouse brain tissues, but not in thymus, spleen, kidney, liver, lung, testis or heart. Pliotrophin has the ability to promote adhesion, migration, expansion, and differentiation of human osteoprogenitor cells. In addition to certain types of cancer, the embryonic growth and differentiation factor pleiotrophin is found also in adults in inflammatory diseases. In osteoarthritis, pleiotrophin is especially expressed in early stages, and its concentrations in the synovial fluid could serve as a marker for the progress of the disease. Pleitrophin might be involved in cartilage repair in osteoarthritis, in particular, in earlier stages.

Summary References (6)

References to Osteoblast Specific Factor 1

  • Deuel TF, Zhang N, Yeh HJ, Silos-Santiago I, Wang ZY. Pleiotrophin: a cytokine with diverse functions and a novel signaling pathway. Arch Biochem Biophys. 2002 Jan 15;397 (2):162-71
  • Hida H, Jung CG, Wu CZ, Kim HJ, Kodama Y, Masuda T, Nishino H. Pleiotrophin exhibits a trophic effect on survival of dopaminergic neurons in vitro. Eur J Neurosci. 2003 May;17 (10):2127-34
  • Muramatsu T. Midkine and pleiotrophin: two related proteins involved in development, survival, inflammation and tumorigenesis. J Biochem. 2002 Sep;132 (3):359-71
  • Pufe T, Bartscher M, Petersen W, Tillmann B, Mentlein R. Expression of pleiotrophin, an embryonic growth and differentiation factor, in rheumatoid arthritis. Arthritis Rheum. 2003 Mar;48 (3):660-7
  • Pufe T, Bartscher M, Petersen W, Tillmann B, Mentlein R. Pleiotrophin, an embryonic differentiation and growth factor, is expressed in osteoarthritis. Osteoarthritis Cartilage. 2003 Apr;11 (4):260-4
  • Ulbricht U, Brockmann MA, Aigner A, Eckerich C, Muller S, Fillbrandt R, Westphal M, Lamszus K. Expression and function of the receptor protein tyrosine phosphatase zeta and its ligand pleiotrophin in human astrocytomas. J Neuropathol Exp Neurol. 2003 Dec;62 (12):1265-75
Related Products Docs
Subscribe to Our Newsletter! Discover News from
BioVendor R&D
Subscribe Now
Subscribe to Our Newsletter! Discover News from
BioVendor R&D
Subscribe Now
zavřít