Select country change
Shopping cart (0 , 0,00 ) Menu Search
Manufactured by BioVendor

Osteoblast Specific Factor 2 Human E. coli

  • Regulatory status:RUO
  • Type:Recombinant protein
  • Source:E. coli
  • Other names:Periostin, PN, OSF-2, POSTN, Fasciclin-I like, Osteoblast Specific Factor 2 (Pleiotrophin, PTN, Heparin-binding growth-associated molecule, HB-GAM, Heparin-binding growth factor 8, HBGF-8, OSF-2, Heparin-binding neurite outgrowth-promoting factor 2, HBNF-2, Heparin-binding brain mitogen, HBBM ), NCK
  • Species:Human
Please select your region to see available products and prices.
Cat. No. Size Price


RD172045025 0.025 mg
RD172045100 0.1 mg
PubMed Product Details
Technical Data

Type

Recombinant protein

Description

Total 671 AA. MW: 75 kDa (calculated). UniProtKB acc.no. Q15063. N-Terminal HisTag and Xa – cleavage site 23 AA (highlighted).

Amino Acid Sequence

MGHHHHHHHHHHSSGHIEGRHMRNNHYDKILAHSRIRGRDQGPNVCALQQILGTKKKYFSTCKNWYKKSICGQKTTVLYECCPGYMRMEGMKGCPAVLPIDHVYGTLGIVGATTTQRYSDASKLREEIEGKGSFTYFAPSNEAWDNLDSDIRRGLESNVNVELLNALHSHMINKRMLTKDLKNGMIIPSMYNNLGLFINHYPNGVVTVNCARIIHGNQIATNGVVHVIDRVLTQIGTSIQDFIEAEDDLSSFRAAAITSDILEALGRDGHFTLFAPTNEAFEKLPRGVLERFMGDKVASEALMKYHILNTLQCSESIMGGAVFETLEGNTIEIGCDGDSITVNGIKMVNKKDIVTNNGVIHLIDQVLIPDSAKQVIELAGKQQTTFTDLVAQLGLASALRPDGEYTLLAPVNNAFSDDTLSMVQRLLKLILQNHILKVKVGLNELYNGQILETIGGKQLRVFVYRTAVCIENSCMEKGSKQGRNGAIHIFREIIKPAEKSLHEKLKQDKRFSTFLSLLEAADLKELLTQPGDWTLFVPTNDAFKGMTSEEKEILIRDKNALQNIILYHLTPGVFIGKGFEPGVTNILKTTQGSKIFLKEVNDTLLVNELKSKESDIMTTNGVIHVVDKLLYPADTPVGNDQLLEILNKLIKYIQIKFVRGSTFKEIPVTVY

Source

E. coli

Purity

>90%

SDS-PAGE Gel

12% SDS-PAGE separation of Human OSF-2
1. M.W. marker – 14, 21, 31, 45, 66, 97 kDa
2. reduced and heated sample, 5μg/lane
3. non-reduced and non-heated sample, 5μg/lane

Endotoxin

< 1.0 EU/ug

Formulation

Filtered (0,4 μm) and lyophilized in 0.5 mg/mL in 0.05 M Acetate buffer pH=4.0

Reconstitution

Add 0.1M Acetate buffer pH=4.0 to prepare a working stock solution of approximately 0.5 mg/mL and let the lyophilized pellet dissolve completely at 37°C. For conversion into higher pH value, we recommend intensive dilution by relevant buffer to a concentration of 10μg/mL. In higher concentrations the solubility of this antigen is limited. Filter sterilize your culture media/working solutions containing this non-sterile product before using in cell culture.

Applications

Western blotting, ELISA

Shipping

On ice. Upon receipt, store the product at the temperature recommended below.

Storage/Expiration

Store the lyophilized protein at –80 °C. Lyophilized protein remains stable until the expiry date when stored at –80 °C. Aliquot reconstituted protein to avoid repeated freezing/thawing cycles and store at –80 °C for long term storage. Reconstituted protein can be stored at 4 °C for a week.

Quality Control Test

BCA to determine quantity of the protein.

SDS PAGE to determine purity of the protein.

LAL to determine quantity of endotoxin.

Summary

Research topic

Bone and cartilage metabolism, Cardiovascular disease, Cytokines and chemokines and related molecules, Oncology

Summary

Periostin is a disulfide linked 90 kDa, 811 amino acid protein originally isolated as a osteoblast-specific factor that functions as a cell adhesion molecule for preosteoblasts and is thought to be involved in osteoblast recruitment, attachment and spreading. Additionally, periostin expression has previously been shown to be significantly increased by both transforming growth factor beta-1(TGFbeta1) and bone morphogenetic protein (BMP-2). OSF-2 has a typical signal sequence, followed by a cysteine-rich domain, a fourfold repeated domain and a C-terminal domain. The fourfold repeated domain of OSF-2 shows homology with the insect protein fasciclin Periostin mRNA is expressed in the developing mouse embryonic and fetal heart, and that it is localized to the endocardial cushions that ultimately divide the primitive heart tube into a four-chambered heart.

Product References (9)

References

  • Butcher JT, Norris RA, Hoffman S, Mjaatvedt CH, Markwald RR. Periostinpromotes atrioventricular mesenchyme matrix invasion and remodeling mediated byintegrin signaling through Rho/PI 3-kinase. Dev Biol. 2007 Feb 1;302(1):256-66.Epub 2006 Oct 4. PubMed PMID: 17070513; PubMed Central PMCID: PMC1913192. See more on PubMed
  • Erkan M, Kleeff J, Gorbachevski A, Reiser C, Mitkus T, Esposito I, Giese T,Büchler MW, Giese NA, Friess H. Periostin creates a tumor-supportivemicroenvironment in the pancreas by sustaining fibrogenic stellate cell activity.Gastroenterology. 2007 Apr;132(4):1447-64. Epub 2007 Jan 25. PubMed PMID:17408641. See more on PubMed
  • Kikuchi Y, Kunita A, Iwata C, Komura D, Nishiyama T, Shimazu K, Takeshita K,Shibahara J, Kii I, Morishita Y, Yashiro M, Hirakawa K, Miyazono K, Kudo A,Fukayama M, Kashima TG. The niche component periostin is produced bycancer-associated fibroblasts, supporting growth of gastric cancer through ERKactivation. Am J Pathol. 2014 Mar;184(3):859-70. doi:10.1016/j.ajpath.2013.11.012. Epub 2014 Jan 10. PubMed PMID: 24418260. See more on PubMed
  • Kudo Y, Iizuka S, Yoshida M, Nguyen PT, Siriwardena SB, Tsunematsu T,Ohbayashi M, Ando T, Hatakeyama D, Shibata T, Koizumi K, Maeda M, Ishimaru N,Ogawa I, Takata T. Periostin directly and indirectly promotes tumorlymphangiogenesis of head and neck cancer. PLoS One. 2012;7(8):e44488. doi:10.1371/journal.pone.0044488. Epub 2012 Aug 30. PubMed PMID: 22952986; PubMedCentral PMCID: PMC3431354. See more on PubMed
  • Kühn B, del Monte F, Hajjar RJ, Chang YS, Lebeche D, Arab S, Keating MT.Periostin induces proliferation of differentiated cardiomyocytes and promotescardiac repair. Nat Med. 2007 Aug;13(8):962-9. Epub 2007 Jul 15. PubMed PMID:17632525. See more on PubMed
  • Lorts A, Schwanekamp JA, Elrod JW, Sargent MA, Molkentin JD. Geneticmanipulation of periostin expression in the heart does not affect myocytecontent, cell cycle activity, or cardiac repair. Circ Res. 2009 Jan2;104(1):e1-7. doi: 10.1161/CIRCRESAHA.108.188649. Epub 2008 Nov 26. PubMed PMID:19038863; PubMed Central PMCID: PMC2644415. See more on PubMed
  • Moreno-Rodriguez RA, Krug EL, Reyes L, Markwald RR. Linear array ofmulti-substrate tracts for simultaneous assessment of cell adhesion, migration,and differentiation. Biotechniques. 2017 Dec 1;63(6):267-274. doi:10.2144/000114619. PubMed PMID: 29235973; PubMed Central PMCID: PMC5884634. See more on PubMed
  • Sen K, Lindenmeyer MT, Gaspert A, Eichinger F, Neusser MA, Kretzler M, SegererS, Cohen CD. Periostin is induced in glomerular injury and expressed de novo ininterstitial renal fibrosis. Am J Pathol. 2011 Oct;179(4):1756-67. doi:10.1016/j.ajpath.2011.06.002. Epub 2011 Aug 18. PubMed PMID: 21854746; PubMedCentral PMCID: PMC3181392. See more on PubMed
  • Utispan K, Thuwajit P, Abiko Y, Charngkaew K, Paupairoj A, Chau-in S, ThuwajitC. Gene expression profiling of cholangiocarcinoma-derived fibroblast revealsalterations related to tumor progression and indicates periostin as a poorprognostic marker. Mol Cancer. 2010 Jan 24;9:13. doi: 10.1186/1476-4598-9-13.PubMed PMID: 20096135; PubMed Central PMCID: PMC2841583. See more on PubMed
Summary References (3)

References to Osteoblast Specific Factor 2

  • Horiuchi K, Amizuka N, Takeshita S, Takamatsu H, Katsuura M, Ozawa H, Toyama Y, Bonewald LF, Kudo A. Identification and characterization of a novel protein, periostin, with restricted expression to periosteum and periodontal ligament and increased expression by transforming growth factor beta. J Bone Miner Res. 1999 Jul;14 (7):1239-49
  • Takeshita S, Kikuno R, Tezuka K, Amann E. Osteoblast-specific factor 2: cloning of a putative bone adhesion protein with homology with the insect protein fasciclin I. Biochem J. 1993 Aug 15;294 ( Pt 1):271-8
  • Ulstrup JC, Jeansson S, Wiker HG, Harboe M. Relationship of secretion pattern and MPB70 homology with osteoblast-specific factor 2 to osteitis following Mycobacterium bovis BCG vaccination. Infect Immun. 1995 Feb;63 (2):672-5
Related Products Docs