Select country change
Shopping cart (0 , 0,00 ) Menu Search
Manufactured by BioVendor

Pancreatitis-Associated Protein-1 Human E. coli

  • Regulatory status:RUO
  • Type:Recombinant protein
  • Source:E. coli
  • Other names:PAP-1, Regenerating islet-derived protein 3 alpha, Reg III-alpha, Pancreatitis-associated protein 1, REG3A, HIP, PAP, PAP1, REG3, INGAP, PAP-H, PBCGF, REG-III
  • Species:Human
Please select your region to see available products and prices.
Cat. No. Size Price


RD172085100 0.1 mg
PubMed Product Details
Technical Data

Type

Recombinant protein

Description

Total 165 AA. MW: 18.4 kDa (calculated). UniProtKB acc.no. Q06141. N-Terminal His-tag 16 AA (highlighted).

Amino Acid Sequence

MRGSHHHHHHGMASHMEEPQRELPSARIRCPKGSKAYGSHCYALFLSPKSWTDADLACQKRPSGNLVSVLSGAEGSFVSSLVKSIGNSYSYVWIGLHDPTQGTEPNGEGWEWSSSDVMNYFAWERNPSTISSPGHCASLSRSTAFLRWKDYNCNVRLPYVCKFTD

Source

E. coli

Purity

Purity as determined by densitometric image analysis: > 95%

SDS-PAGE Gel

12% SDS-PAGE separation of Human PAP-1
1. M.W. marker – 14, 21, 31, 45, 66, 97 kDa
2. reduced and heated sample, 5μg/lane
3. non-reduced and non-heated sample, 5μg/lane

Endotoxin

< 0.1 EU/μg

Formulation

Filtered (0.4 μm) and lyophilized in 0.5 mg/mL in 0.05M Acetate buffer pH =4.0

Reconstitution

Add 0.1M Acetate buffer pH4 to prepare a working stock solution of approximately 0.5 mg/mL and let the lyophilized pellet dissolve completely. For conversion into higher pH value, we recommend intensive dilution by relevant buffer to a concentration of 10μg/mL. In higher concentrations the solubility of this antigen is limited. Filter sterilize your culture media/working solutions containing this non-sterile product before using in cell culture.

Applications

Western blotting

Shipping

On ice. Upon receipt, store the product at the temperature recommended below.

Storage/Expiration

Store the lyophilized protein at –80 °C. Lyophilized protein remains stable until the expiry date when stored at –80 °C. Aliquot reconstituted protein to avoid repeated freezing/thawing cycles and store at –80 °C for long term storage. Reconstituted protein can be stored at 4 °C for three days.

Quality Control Test

BCA to determine quantity of the protein.

SDS PAGE to determine purity of the protein.

LAL to determine quantity of endotoxin.

Note

This product is intended for research use only.

Summary

Research topic

Pancreatic regulatory molecules

Summary

Pancreatitis-associated protein (PAP) is a secretory protein not normally expressed in healthy pancreas but highly induced during acute pancreatitis. While PAP has been shown to be anti-bacterial and anti-apoptotic in vitro, its definitive biological function in vivo is not clear. Using antisepse oligonucleotides, inhibition of PAP expression significantly worsened pancreatitis in a rat model. During pancreatitis, PAP released by the pancreas could mediate lung inflammation through induction of hepatic TNFalpha expression and subsequent increase in circulating TNFalpha. PAP is activated in primary liver cancers. In normal liver, the protein is undetectable in normal mature hepatocytes and found only in some ductular cells, representing potential hepatic progenitor cells. PAP can be considered hepatic cytokine that combines mitogenic and anti-apoptotic functions regarding hepatocytes, and consequently acts as a growth factor in vivo to enhance liver regeneration. In pancreatic cancor, PAP was overexpressed in 79% (30 of 38) of pancreatic ductal adenocarcinoma, 19% (7 of 36) of chronic pancreatitis, and 29% (2 of 7) of mucinous cystadenoma. PAP was found in malignant ductular structures in pancreatic carcinomas as well as in benign proliferating ductules and acinar cells in chronic pancreatitis. Elevation of PAP in patients with pancreatic cancer is not merely explainable by concomitant pancreatitis, but seems to be due to increased PAP production by the cancer cells and is also correlated to tumour load as expressed by the UICC stages. Epithelial expression of PAP was induced under intestinal mucosal inflammation initiated by exposure to commensal bacteria or DSS as well as inflamed IBD colon. Increased serum level of PAP diagnosed ileal location in active Crohn disease with a sensitivity of 60%, a specificity of 94%, a positive predictive value of 84% and a negative predictive value of 81%. Elevated serum PAP (> 50 ng/mL ) is significantly associated with disease activity and ileal location of Crohn disease.

Product References (1)

References

  • Breyner NM, Vilas Boas PB, Fernandes G, de Carvalho RD, Rochat T, Michel ML,Chain F, Sokol H, de Azevedo M, Myioshi A, Azevedo VA, Langella P,Bermúdez-Humarán LG, Chatel JM. Oral delivery of pancreatitis-associated protein by Lactococcus lactis displays protective effects indinitro-benzenesulfonic-acid-induced colitis model and is able to modulate thecomposition of the microbiota. Environ Microbiol. 2019 Nov;21(11):4020-4031. doi:10.1111/1462-2920.14748. Epub 2019 Sep 10. PubMed PMID: 31325218; PubMed Central PMCID: PMC6899824. See more on PubMed
Summary References (7)

References to Pancreatitis-Associated Protein-1

  • Cerwenka H, Aigner R, Bacher H, Werkgartner G, el-Shabrawi A, Quehenberger F, Mischinger HJ. Pancreatitis-associated protein (PAP) in patients with pancreatic cancer. Anticancer Res. 2001 Mar-Apr;21 (2B):1471-4
  • Desjeux A, Barthet M, Barthellemy S, Dagorn JC, Hastier P, Heresbach D, Bernard JP, Grimaud JC. Serum measurements of pancreatitis associated protein in active Crohn's disease with ileal location. Gastroenterol Clin Biol. 2002 Jan;26 (1):23-8
  • Motoo Y, Satomura Y, Mouri I, Mouri H, Ohtsubo K, Sakai J, Fujii T, Taga H, Yamaguchi Y, Watanabe H, Okai T, Sawabu N. Serum levels of pancreatitis-associated protein in digestive diseases with special reference to gastrointestinal cancers. Dig Dis Sci. 1999 Jun;44 (6):1142-7
  • Motoo Y, Watanabe H, Yamaguchi Y, Xie MJ, Mouri H, Ohtsubo K, Okai T, Wakabayashi T, Sawabu N. Pancreatitis-associated protein levels in pancreatic juice from patients with pancreatic diseases. Pancreatology. 2001;1 (1):43-7
  • Sarles J, Barthellemy S, Ferec C, Iovanna J, Roussey M, Farriaux JP, Toutain A, Berthelot J, Maurin N, Codet JP, Berthezene P, Dagorn JC. Blood concentrations of pancreatitis associated protein in neonates: relevance to neonatal screening for cystic fibrosis. Arch Dis Child Fetal Neonatal . 1999 Mar;80 (2):F118-22
  • Valery C, Vasseur S, Sabatier F, Iovanna JL, Dagorn JC, Grob JJ, Verrando P. Pancreatitis associated protein I (PAP-I) alters adhesion and motility of human melanocytes and melanoma cells. J Invest Dermatol. 2001 Mar;116 (3):426-33
  • Xie MJ, Motoo Y, Iovanna JL, Su SB, Ohtsubo K, Matsubara F, Sawabu N. Overexpression of pancreatitis-associated protein (PAP) in human pancreatic ductal adenocarcinoma. Dig Dis Sci. 2003 Mar;48 (3):459-64
Related Products Docs