United States set
language
Menu Shopping cart $0 Search
Manufactured by BioVendor

Pulmonary Surfactant-Associated Protein B Human HEK293

  • Regulatory status:RUO
  • Type:Recombinant protein
  • Source:HEK293
  • Other names:Surfactant Protein B; SP-B; 18 kDa pulmonary-surfactant protein; 6 kDa protein; Pulmonary surfactant-associated proteolipid SPL (Phe); SFTP3; Surfactant, Pulmonary-Associated Protein B; SMDP1; SFTB3
  • Species:Human
United States orders are shipped from our US branch, BioVendor, LLC
Cat. No. Size Price
1 - 4 pcs / 5 - 9 pcs / 10+ pcs


RD172520100 0.1 mg $421 / $370 / On request
PubMed Product Details
Technical Data

Type

Recombinant protein

Description

Total 363 AA. MW: 40.4 kDa (calculated). UniProtKB acc. No. P07988 (Trp25–Leu381). C-terminal His-tag (6 extra AA). Protein identity confirmed by MS.

Amino Acid Sequence

WTTSSLACAQGPEFWCQSLEQALQCRALGHCLQEVWGHVGADDLCQECEDIVHILNKMAKEAIFQDTMRKFLEQECNVLPLKLLMPQCNQVLDDYFPLVIDYFQNQTDSNGICMHLGLCKSRQPEPEQEPGMSDPLPKPLRDPLPDPLLDKLVLPVLPGALQARPGPHTQDLSEQQFPIPLPYCWLCRALIKRIQAMIPKGALAVAVAQVCRVVPLVAGGICQCLAERYSVILLDTLLGRMLPQLVCRLVLRCSMDDSAGPRSPTGEWLPRDSECHLCMSVTTQAGNSSEQAIPQAMLQACVGSWLDREKCKQFVEQHTPQLLTLVPRGWDAHTTCQALGVCGTMSSPLQCIHSPDLHHHHHH

Source

HEK293

Purity

˃ 90 % by SDS-PAGE

SDS-PAGE Gel

12 % SDS-PAGE separation of Human SP-B (HEK):

  1. M.W. marker – 14, 21, 31, 45, 66, 97 kDa
  2. Reduced and boiled sample, 2.5 μg/lane
  3. Non-reduced and non-boiled sample, 2.5 μg/lane

Endotoxin

< 1.0 EU/µg

Formulation

Filtered (0.4 μm) and lyophilized from 0.5 mg/ml solution in phosphate buffered saline, 5% w/v trehalose pH 7,4.

Reconstitution

Add 200 µl of deionized water to prepare a working stock solution of approximately 0.5 mg/ml and let the lyophilized pellet dissolve completely.

Applications

Western blotting, ELISA

Shipping

At ambient temperature. Upon receipt, store the product at the temperature recommended below.

Storage/Expiration

Store lyophilized protein at -80°C. Lyophilized protein remains stable until the expiry date when stored at -80°C. Aliquot reconstituted protein to avoid repeated freezing/thawing cycles and store at -80°C for long term storage. Reconstituted protein can be stored at 4°C for a week.

Quality Control Test

BCA to determine quantity of the protein.
SDS PAGE to determine purity of the protein. Endotoxin level determination.

Note

This product is intended for research use only.

Related Products Docs
Subscribe to Our Newsletter! Discover News from
BioVendor R&D
Subscribe Now
Subscribe to Our Newsletter! Discover News from
BioVendor R&D
Subscribe Now
zavřít