Select country change
Shopping cart (0 , 0,00 ) Menu Search
Manufactured by BioVendor

Pulmonary Surfactant-Associated Protein B Human HEK293

  • Regulatory status:RUO
  • Type:Recombinant
  • Source:HEK293
  • Other names:Surfactant Protein B; SP-B; 18 kDa pulmonary-surfactant protein; 6 kDa protein; Pulmonary surfactant-associated proteolipid SPL (Phe); SFTP3; Surfactant, Pulmonary-Associated Protein B; SMDP1; SFTB3
  • Species:Human
Please select your region to see available products and prices.
Cat. No. Size Price


New RD172520100 0.1 mg
PubMed Product Details
Technical Data

Type

Recombinant

Description

Total 363 AA. MW: 40.4 kDa (calculated). UniProtKB acc. No. P07988 (Trp25–Leu381). C-terminal His-tag (6 extra AA). Protein identity confirmed by LC-MS/MS.

Amino Acid Sequence

WTTSSLACAQGPEFWCQSLEQALQCRALGHCLQEVWGHVGADDLCQECEDIVHILNKMAKEAIFQDTMRKFLEQECNVLPLKLLMPQCNQVLDDYFPLVIDYFQNQTDSNGICMHLGLCKSRQPEPEQEPGMSDPLPKPLRDPLPDPLLDKLVLPVLPGALQARPGPHTQDLSEQQFPIPLPYCWLCRALIKRIQAMIPKGALAVAVAQVCRVVPLVAGGICQCLAERYSVILLDTLLGRMLPQLVCRLVLRCSMDDSAGPRSPTGEWLPRDSECHLCMSVTTQAGNSSEQAIPQAMLQACVGSWLDREKCKQFVEQHTPQLLTLVPRGWDAHTTCQALGVCGTMSSPLQCIHSPDLHHHHHH

Source

HEK293

Purity

Purity as determined by densitometric image analysis: > 95 %

SDS-PAGE Gel

12 % SDS-PAGE separation of Human SP-B (HEK):

  1. M.W. marker – 14, 21, 31, 45, 66, 97 kDa
  2. Reduced and boiled sample, 2.5 μg/lane
  3. Non-reduced and non-boiled sample, 2.5 μg/lane

Endotoxin

< 1.0 EU/µg

Formulation

Filtered (0.4 μm) and lyophilized from 0.5 mg/ml solution in phosphate buffered saline, 5% w/v trehalose pH 7,4.

Reconstitution

Add 200 µl of deionized water to prepare a working stock solution of approximately 0.5 mg/ml and let the lyophilized pellet dissolve completely.

Applications

Western blotting, ELISA

Shipping

At temperature 2 – 8°C. Upon receipt, store the product at the temperature recommended below.

Storage/Expiration

Store lyophilized protein at –80°C. Lyophilized protein remains stable until the expiry date when stored at –80°C. Aliquot reconstituted protein to avoid repeated freezing/thawing cycles and store at –80°C for long term storage. Reconstituted protein can be stored at 4°C for a week.

Quality Control Test

BCA to determine quantity of the protein.

SDS PAGE to determine purity of the protein.

LAL to determine quantity of endotoxin.

Note

This product is intended for research use only.

Related Products Documents