United States set
language
Menu Shopping cart $0 Search
Manufactured by BioVendor

Retinol Binding Protein 4 Human E. coli

  • Regulatory status:RUO
  • Type:Recombinant protein
  • Source:E. coli
  • Other names:Plasma retinol-binding protein, PRBP, RBP, RBP4, PRO2222
  • Species:Human
Cat. No. Size Price


RD172104100 0.1 mg
PubMed Product Details
Technical Data

Type

Recombinant protein

Description

Total 211 AA. MW: 24.4 kDa (calculated). N-terminal His-Tag and TEV cleavage site, 28 extra AA.

Amino Acid Sequence

MSYYHHHHHHDYDIPTTENLYFQGAMGSERDCRVSSFRVKENFDKARFSGTWYAMAKKDPEGLFLQDNIVAEFSVDETGQMSATAKGRVRLLNNWDVCADMVGTFTDTEDPAKFKMKYWGVASFLQKGNDDHWIVDTDYDTYAVQYSCRLLNLDGTCADSYSFVFSRDPNGLPPEAQKIVRQRQEELCLARQYRLIVHNGYCDGRSERNLL

Source

E. coli

Purity

˃ 90 % by SDS-PAGE

SDS-PAGE Gel

Endotoxin

< 1.0 EU/μg

Formulation

Lyophilized in 1 mg-mL in PBS.

Reconstitution

Add deionized water to prepare a working stock solution of approximately 1 mg/mL and let the lyophilized pellet dissolve completely.

Applications

Western blotting, ELISA

Storage/Expiration

Store lyophilized protein at -20 °C. Aliquot reconstituted protein and store at -80 °C. Avoid repeated freezing/thawing cycles.

Note

This product is intended for research use only.

Summary

Research topic

Diabetology - Other Relevant Products, Energy metabolism and body weight regulation

Summary

Retinol binding protein (RBP) 4 is the only specific transport protein for vitamin A in the circulation whose function is to deliver vitamin to target tissues (1). In obesity and type 2 diabetes, expression of Glut4 is significantly impaired in adipocytes. Glucose transport via Glut4 is the rate-limiting step for glucose use by muscle and adipose tissue (2). Yang et al. noted that adipocyte-specific deletion of Gluts led to notable elevation of RBP4 causing systemic insulin resistance, and that reduction of RBP4 improved insulin resistance (3). This identified a novel role of RBP4 in regulating insulin action and RBP4 is recorded as an adipocyte-derived hormone. Thus, measurement of serum or plasma RBP4 is a useful means for understanding of metabolic disorders.

Summary References (3)

References to Retinol Binding Protein 4

  • Quadro L, Blaner WS, Salchow DJ, Vogel S, Piantedosi R, Gouras P, Freeman S, Cosma MP, Colantuoni V, Gottesman ME. Impaired retinal function and vitamin A availability in mice lacking retinol-binding protein. EMBO J. 1999 Sep 1;18 (17):4633-44
  • Shepherd PR, Kahn BB. Glucose transporters and insulin action--implications for insulin resistance and diabetes mellitus. N Engl J Med. 1999 Jul 22;341 (4):248-57
  • Yang Q, Graham TE, Mody N, Preitner F, Peroni OD, Zabolotny JM, Kotani K, Quadro L, Kahn BB. Serum retinol binding protein 4 contributes to insulin resistance in obesity and type 2 diabetes. Nature. 2005 Jul 21;436 (7049):356-62
Related Products Docs
Subscribe to Our Newsletter! Discover News from
BioVendor R&D
Subscribe Now
Subscribe to Our Newsletter! Discover News from
BioVendor R&D
Subscribe Now
zavřít