United States set
language
Menu Shopping cart $0 Search
Manufactured by BioVendor

Soluble Receptor for Advanced Glycation End Products (sRAGE) Human, Sheep Polyclonal Antibody

  • Regulatory status:RUO
  • Type:Polyclonal Antibody
  • Other names:Soluble Receptor for Advanced Glycation End Products, sRAGE, Advanced glycation end product-specific receptor, AGER, RAGE
  • Species:Human
Cat. No. Size Price
1 pc / 2 - 5 pcs / 6+ pcs


RD184116100 0.1 mg $277 / $243 / On request
PubMed Product Details
Technical Data

Type

Polyclonal Antibody

Applications

Western blotting, ELISA

Source of Antigen

E. coli

Hosts

Sheep

Preparation

The antibody was raised in sheep by immunization with the recombinant Human sRAGE.

Amino Acid Sequence

The immunization antigen (36.5 kDa) is a protein containing 325 AA of recombinant Human sRAGE and 14 extra AA, N-terminal His-tag.

MRGSHHHHHHGMASAQNITARIGEPLVLKCKGAPKKPPQRLEWKLNTGRTEAWKVLSPQGGGPWDSVARVLPNGSLFLPAVGIQDEGIFRCQAMNRNGKETKSNYRVRVYQIPGKPEIVDSASELTAGVPNKVGTCVSEGSYPAGTLSWHLDGKPLVPNEKGVSVKEQTRRHPETGLFTLQSELMVTPARGGDPRPTFSCSFSPGLPRHRALRTAPIQPRVWEPVPLEEVQLVVEPEGGAVAPGGTVTLTCEVPAQPSPQIHWMKDGVPLPLPPSPVLILPEIGPQDQGTYSCVATHSSHGPQESRAVSISIIEPGEEGPTAGEGFDKVREAEDSPQHM

Species Reactivity

Human. Not yet tested in other species.

Purification Method

Immunoaffinity chromatography on a column with immobilized recombinant Human sRAGE.

Antibody Content

0.1 mg (determined by BCA method, BSA was used as a standard)

Formulation

The antibody is lyophilized in 0.05 M phosphate buffer, 0.1 M NaCl, pH 7.2. 

Reconstitution

Add 0.2 ml of deionized water and let the lyophilized pellet dissolve completely. Slight turbidity may occur after reconstitution, which does not affect activity of the antibody. In this case clarify the solution by centrifugation.

Shipping

At ambient temperature. Upon receipt, store the product at the temperature recommended below.

Storage/Expiration

The lyophilized antibody remains stable and fully active until the expiry date when stored at -20°C.Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles and store frozen at -80°C. Reconstituted antibody can be stored at 4°C for a limited period of time; it does not show decline in activity after one week at 4°C.

Quality Control Test

Indirect ELISA – to determine titer of the antibody SDS PAGE – to determine purity of the antibody BCA - to determine quantity of the antibody

Note

This product is for research use only.

Summary

Research topic

Diabetology - Other Relevant Products, Neural tissue markers, Pulmonary diseases, Renal disease

Summary

The receptor for advanced glycation end products (RAGE) is a multiligand member of the immunoglobulin superfamily of cell surface molecules. It mediates interactions of advanced glycation end products (AGE), the products of nonenzymatic glycoxidation of proteins/lipids that accumulate in the plasma and tissues of patients with diabetes.

Summary References (12)

References to Soluble Receptor for Advanced Glycation End Products (sRAGE)

  • Brett J, Schmidt AM, Yan SD, Zou YS, Weidman E, Pinsky D, Nowygrod R, Neeper M, Przysiecki C, Shaw A, et al. Survey of the distribution of a newly characterized receptor for advanced glycation end products in tissues. Am J Pathol. 1993 Dec;143 (6):1699-712
  • Emanuele E, D'Angelo A, Tomaino C, Binetti G, Ghidoni R, Politi P, Bernardi L, Maletta R, Bruni AC, Geroldi D. Circulating levels of soluble receptor for advanced glycation end products in Alzheimer disease and vascular dementia. Arch Neurol. 2005 Nov;62 (11):1734-6
  • Falcone C, Emanuele E, D'Angelo A, Buzzi MP, Belvito C, Cuccia M, Geroldi D. Plasma levels of soluble receptor for advanced glycation end products and coronary artery disease in nondiabetic men. Arterioscler Thromb Vasc Biol. 2005 May;25 (5):1032-7
  • Geroldi D, Falcone C, Emanuele E. Soluble receptor for advanced glycation end products: from disease marker to potential therapeutic target. Curr Med Chem. 2006;13 (17):1971-8
  • Ghidoni R, Benussi L, Glionna M, Franzoni M, Geroldi D, Emanuele E, Binetti G. Decreased plasma levels of soluble receptor for advanced glycation end products in mild cognitive impairment. J Neural Transm. 2008 Jul;115 (7):1047-50
  • Goh SY, Cooper ME. Clinical review: The role of advanced glycation end products in progression and complications of diabetes. J Clin Endocrinol Metab. 2008 Apr;93 (4):1143-52
  • Goldin A, Beckman JA, Schmidt AM, Creager MA. Advanced glycation end products: sparking the development of diabetic vascular injury. Circulation. 2006 Aug 8;114 (6):597-605
  • Gugliucci A. Glycation as the glucose link to diabetic complications. J Am Osteopath Assoc. 2000 Oct;100 (10):621-34
  • Hudson BI, Harja E, Moser B, Schmidt AM. Soluble levels of receptor for advanced glycation endproducts (sRAGE) and coronary artery disease: the next C-reactive protein?. Arterioscler Thromb Vasc Biol. 2005 May;25 (5):879-82
  • Kalousova M, Hodkova M, Kazderova M, Fialova J, Tesar V, Dusilova-Sulkova S, Zima T. Soluble receptor for advanced glycation end products in patients with decreased renal function. Am J Kidney Dis. 2006 Mar;47 (3):406-11
  • Pullerits R, Bokarewa M, Dahlberg L, Tarkowski A. Decreased levels of soluble receptor for advanced glycation end products in patients with rheumatoid arthritis indicating deficient inflammatory control. Arthritis Res Ther. 2005;7 (4):R817-24
  • Schmidt AM, Vianna M, Gerlach M, Brett J, Ryan J, Kao J, Esposito C, Hegarty H, Hurley W, Clauss M, et al. Isolation and characterization of two binding proteins for advanced glycosylation end products from bovine lung which are present on the endothelial cell surface. J Biol Chem. 1992 Jul 25;267 (21):14987-97
Related Products Docs